BLASTX nr result
ID: Glycyrrhiza28_contig00028580
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00028580 (214 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019020703.1 hypothetical protein SAICODRAFT_195399 [Saitoella... 50 2e-06 >XP_019020703.1 hypothetical protein SAICODRAFT_195399 [Saitoella complicata NRRL Y-17804] ODQ49590.1 hypothetical protein SAICODRAFT_195399 [Saitoella complicata NRRL Y-17804] Length = 80 Score = 50.1 bits (118), Expect = 2e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 101 GPTRVMLLEITTRTPKVPDYKFELFPLRSPLLG 3 GP LLEITTRT + PD+KFELFPL SPLLG Sbjct: 25 GPHPKTLLEITTRTAERPDFKFELFPLHSPLLG 57