BLASTX nr result
ID: Glycyrrhiza28_contig00028528
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00028528 (219 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024581661.1 MULTISPECIES: N-acetyltransferase [Bradyrhizobium... 87 9e-20 WP_029077966.1 N-acetyltransferase [Bradyrhizobium sp. th.b2] 87 1e-19 WP_044542798.1 N-acetyltransferase [Bradyrhizobium sp. LTSP885] ... 86 3e-19 SED39665.1 Protein N-acetyltransferase, RimJ/RimL family [Bradyr... 86 5e-19 ERF80131.1 acetoacetyl-CoA reductase [Bradyrhizobium sp. DFCI-1] 86 5e-19 WP_076832564.1 GNAT family N-acetyltransferase [Bradyrhizobium s... 85 1e-18 WP_057020074.1 N-acetyltransferase [Bradyrhizobium pachyrhizi] K... 85 1e-18 WP_050382546.1 N-acetyltransferase [Bradyrhizobium pachyrhizi] 85 1e-18 WP_038384829.1 N-acetyltransferase [Bradyrhizobium elkanii] 85 1e-18 WP_028339129.1 N-acetyltransferase [Bradyrhizobium elkanii] 85 1e-18 WP_028336582.1 N-acetyltransferase [Bradyrhizobium elkanii] 85 1e-18 WP_016846801.1 GNAT family N-acetyltransferase [Bradyrhizobium e... 85 1e-18 WP_050403878.1 N-acetyltransferase [Bradyrhizobium embrapense] 84 2e-18 WP_074125198.1 GNAT family N-acetyltransferase [Bradyrhizobium s... 84 3e-18 WP_050629524.1 N-acetyltransferase [Bradyrhizobium viridifuturi] 84 3e-18 WP_044590402.1 N-acetyltransferase [Bradyrhizobium sp. LTSPM299]... 83 4e-18 SDE27937.1 Protein N-acetyltransferase, RimJ/RimL family [Bradyr... 83 4e-18 WP_069280398.1 N-acetyltransferase [Bradyrhizobium elkanii] ODM7... 82 1e-17 WP_066513217.1 N-acetyltransferase [Bradyrhizobium sp. BR 10303]... 82 1e-17 SDT38721.1 Protein N-acetyltransferase, RimJ/RimL family [Bradyr... 75 7e-15 >WP_024581661.1 MULTISPECIES: N-acetyltransferase [Bradyrhizobium] KIU46843.1 GNAT family acetyltransferase [Bradyrhizobium elkanii] OCX29682.1 GNAT family N-acetyltransferase [Bradyrhizobium sp. UASWS1016] Length = 207 Score = 87.4 bits (215), Expect = 9e-20 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M ALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQ+YIRSLSA Sbjct: 1 MTALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQSYIRSLSA 46 >WP_029077966.1 N-acetyltransferase [Bradyrhizobium sp. th.b2] Length = 207 Score = 87.0 bits (214), Expect = 1e-19 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M+AL LDDLKQYSDVLRAK+GSEIKVRFVEPRDREELQNYIRSLSA Sbjct: 1 MVALHLDDLKQYSDVLRAKNGSEIKVRFVEPRDREELQNYIRSLSA 46 >WP_044542798.1 N-acetyltransferase [Bradyrhizobium sp. LTSP885] KJC33515.1 GNAT family acetyltransferase [Bradyrhizobium sp. LTSP885] Length = 206 Score = 85.9 bits (211), Expect = 3e-19 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLS 6 M ALRLDDLKQYSDVLRAK+GSEIKVRFVEPRDREELQNYIRSLS Sbjct: 1 MTALRLDDLKQYSDVLRAKNGSEIKVRFVEPRDREELQNYIRSLS 45 >SED39665.1 Protein N-acetyltransferase, RimJ/RimL family [Bradyrhizobium erythrophlei] Length = 207 Score = 85.5 bits (210), Expect = 5e-19 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M AL LDDLKQYSDVLRAK+GSEIKVRFVEPRDREELQNYIRSLSA Sbjct: 1 MAALHLDDLKQYSDVLRAKNGSEIKVRFVEPRDREELQNYIRSLSA 46 >ERF80131.1 acetoacetyl-CoA reductase [Bradyrhizobium sp. DFCI-1] Length = 207 Score = 85.5 bits (210), Expect = 5e-19 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M AL LDDLKQYSDVLRAK+GSEIKVRFVEPRDREELQNYIRSLSA Sbjct: 1 MTALHLDDLKQYSDVLRAKNGSEIKVRFVEPRDREELQNYIRSLSA 46 >WP_076832564.1 GNAT family N-acetyltransferase [Bradyrhizobium sp. UFLA 03-321] OMI02102.1 GNAT family N-acetyltransferase [Bradyrhizobium sp. UFLA 03-321] Length = 207 Score = 84.7 bits (208), Expect = 1e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M+AL LDDLKQYSDVLRAK+GSE+KVRFVEPRDREELQ+YIRSLSA Sbjct: 1 MVALHLDDLKQYSDVLRAKNGSEVKVRFVEPRDREELQSYIRSLSA 46 >WP_057020074.1 N-acetyltransferase [Bradyrhizobium pachyrhizi] KRP87250.1 GNAT family acetyltransferase [Bradyrhizobium pachyrhizi] Length = 207 Score = 84.7 bits (208), Expect = 1e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M+AL LDDLKQYSDVLRAK+GSE+KVRFVEPRDREELQ+YIRSLSA Sbjct: 1 MVALHLDDLKQYSDVLRAKNGSEVKVRFVEPRDREELQSYIRSLSA 46 >WP_050382546.1 N-acetyltransferase [Bradyrhizobium pachyrhizi] Length = 207 Score = 84.7 bits (208), Expect = 1e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M+AL LDDLKQYSDVLRAK+GSE+KVRFVEPRDREELQ+YIRSLSA Sbjct: 1 MVALHLDDLKQYSDVLRAKNGSEVKVRFVEPRDREELQSYIRSLSA 46 >WP_038384829.1 N-acetyltransferase [Bradyrhizobium elkanii] Length = 207 Score = 84.7 bits (208), Expect = 1e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M+AL LDDLKQYSDVLRAK+GSE+KVRFVEPRDREELQ+YIRSLSA Sbjct: 1 MVALHLDDLKQYSDVLRAKNGSEVKVRFVEPRDREELQSYIRSLSA 46 >WP_028339129.1 N-acetyltransferase [Bradyrhizobium elkanii] Length = 207 Score = 84.7 bits (208), Expect = 1e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M+AL LDDLKQYSDVLRAK+GSE+KVRFVEPRDREELQ+YIRSLSA Sbjct: 1 MVALHLDDLKQYSDVLRAKNGSEVKVRFVEPRDREELQSYIRSLSA 46 >WP_028336582.1 N-acetyltransferase [Bradyrhizobium elkanii] Length = 207 Score = 84.7 bits (208), Expect = 1e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M+AL LDDLKQYSDVLRAK+GSE+KVRFVEPRDREELQ+YIRSLSA Sbjct: 1 MVALHLDDLKQYSDVLRAKNGSEVKVRFVEPRDREELQSYIRSLSA 46 >WP_016846801.1 GNAT family N-acetyltransferase [Bradyrhizobium elkanii] OIM92359.1 GNAT family N-acetyltransferase [Bradyrhizobium elkanii] Length = 207 Score = 84.7 bits (208), Expect = 1e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M+AL LDDLKQYSDVLRAK+GSE+KVRFVEPRDREELQ+YIRSLSA Sbjct: 1 MVALHLDDLKQYSDVLRAKNGSEVKVRFVEPRDREELQSYIRSLSA 46 >WP_050403878.1 N-acetyltransferase [Bradyrhizobium embrapense] Length = 207 Score = 84.0 bits (206), Expect = 2e-18 Identities = 42/46 (91%), Positives = 43/46 (93%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M AL LDDLKQYSDVLRAKDGSE+KVRFVEPRDREELQ YIRSLSA Sbjct: 1 MTALHLDDLKQYSDVLRAKDGSEVKVRFVEPRDREELQAYIRSLSA 46 >WP_074125198.1 GNAT family N-acetyltransferase [Bradyrhizobium sp. NAS96.2] OKO83119.1 GNAT family acetyltransferase [Bradyrhizobium sp. NAS96.2] Length = 207 Score = 83.6 bits (205), Expect = 3e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M AL LDDLKQYSDVLRAK+GSEIKVRFVEPRDREELQ+YIRSLSA Sbjct: 1 MTALHLDDLKQYSDVLRAKNGSEIKVRFVEPRDREELQSYIRSLSA 46 >WP_050629524.1 N-acetyltransferase [Bradyrhizobium viridifuturi] Length = 207 Score = 83.6 bits (205), Expect = 3e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M AL LDDLKQYSDVLRAK+GSEIKVRFVEPRDREELQ+YIRSLSA Sbjct: 1 MTALHLDDLKQYSDVLRAKNGSEIKVRFVEPRDREELQSYIRSLSA 46 >WP_044590402.1 N-acetyltransferase [Bradyrhizobium sp. LTSPM299] KJC57649.1 GNAT family acetyltransferase [Bradyrhizobium sp. LTSPM299] Length = 206 Score = 83.2 bits (204), Expect = 4e-18 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLS 6 M A RLDDLKQYSDVLRAK+GSEIKVRFVEPRDREELQNYIRSLS Sbjct: 1 MTAPRLDDLKQYSDVLRAKNGSEIKVRFVEPRDREELQNYIRSLS 45 >SDE27937.1 Protein N-acetyltransferase, RimJ/RimL family [Bradyrhizobium sp. R5] Length = 207 Score = 83.2 bits (204), Expect = 4e-18 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M+AL LDDLKQYSDVLRAK+G E+KVRFVEPRDREELQ+YIRSLSA Sbjct: 1 MVALHLDDLKQYSDVLRAKNGGEVKVRFVEPRDREELQSYIRSLSA 46 >WP_069280398.1 N-acetyltransferase [Bradyrhizobium elkanii] ODM70882.1 GNAT family acetyltransferase [Bradyrhizobium elkanii] ODM80319.1 GNAT family acetyltransferase [Bradyrhizobium elkanii] Length = 207 Score = 82.0 bits (201), Expect = 1e-17 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M+AL LDD +QYSDVLRAK+GSE+KVRFVEPRDREELQ+YIRSLSA Sbjct: 1 MVALHLDDFRQYSDVLRAKNGSEVKVRFVEPRDREELQSYIRSLSA 46 >WP_066513217.1 N-acetyltransferase [Bradyrhizobium sp. BR 10303] KWV48832.1 GNAT family acetyltransferase [Bradyrhizobium sp. BR 10303] Length = 207 Score = 82.0 bits (201), Expect = 1e-17 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLSA 3 M ALRL+DLKQYSDVLRAKDGSEIKVRFVE RDREELQ+YIRSLSA Sbjct: 1 MAALRLNDLKQYSDVLRAKDGSEIKVRFVERRDREELQSYIRSLSA 46 >SDT38721.1 Protein N-acetyltransferase, RimJ/RimL family [Bradyrhizobium canariense] Length = 207 Score = 74.7 bits (182), Expect = 7e-15 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -2 Query: 140 MIALRLDDLKQYSDVLRAKDGSEIKVRFVEPRDREELQNYIRSLS 6 MIALR DDLKQYSDVLR+++GS + VRF+EPRD EELQNY RSLS Sbjct: 1 MIALRFDDLKQYSDVLRSRNGSAVTVRFIEPRDAEELQNYFRSLS 45