BLASTX nr result
ID: Glycyrrhiza28_contig00028188
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00028188 (255 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB18403.1 hypothetical protein B456_003G050800 [Gossypium raimo... 144 4e-38 KHG12917.1 Pentatricopeptide repeat-containing, chloroplastic -l... 144 4e-38 KJB18402.1 hypothetical protein B456_003G050800 [Gossypium raimo... 144 4e-38 XP_017622895.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 4e-38 XP_016710927.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 4e-38 XP_013733140.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 4e-38 XP_012469966.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 4e-38 OMO95208.1 hypothetical protein CCACVL1_05491 [Corchorus capsula... 144 4e-38 XP_016740946.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 4e-38 OMP05352.1 hypothetical protein COLO4_08905 [Corchorus olitorius] 144 4e-38 XP_008245022.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 4e-38 XP_008233573.1 PREDICTED: pentatricopeptide repeat-containing pr... 144 4e-38 XP_015964595.1 PREDICTED: pentatricopeptide repeat-containing pr... 143 5e-38 KHN35111.1 Pentatricopeptide repeat-containing protein, chloropl... 142 1e-37 XP_006590462.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 1e-37 XP_007206704.1 hypothetical protein PRUPE_ppa023974mg [Prunus pe... 142 2e-37 EEF42321.1 pentatricopeptide repeat-containing protein, putative... 142 2e-37 XP_015575189.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 2e-37 ONI02054.1 hypothetical protein PRUPE_6G174500 [Prunus persica] 142 2e-37 XP_007029499.2 PREDICTED: pentatricopeptide repeat-containing pr... 141 2e-37 >KJB18403.1 hypothetical protein B456_003G050800 [Gossypium raimondii] Length = 1261 Score = 144 bits (362), Expect = 4e-38 Identities = 70/84 (83%), Positives = 79/84 (94%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRF KVQE+LD+MR+RGCEPDLVSFNTLINAR+K+ AMVP LA++LLNE+R S Sbjct: 248 MGVYARNGRFQKVQELLDLMRKRGCEPDLVSFNTLINARLKAGAMVPDLAIKLLNEVRRS 307 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+SACSRESNLEE Sbjct: 308 GLRPDIITYNTLISACSRESNLEE 331 >KHG12917.1 Pentatricopeptide repeat-containing, chloroplastic -like protein [Gossypium arboreum] KHG27857.1 Pentatricopeptide repeat-containing, chloroplastic -like protein [Gossypium arboreum] Length = 1296 Score = 144 bits (362), Expect = 4e-38 Identities = 70/84 (83%), Positives = 79/84 (94%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRF KVQE+LD+MR+RGCEPDLVSFNTLINAR+K+ AMVP LA++LLNE+R S Sbjct: 248 MGVYARNGRFQKVQELLDLMRKRGCEPDLVSFNTLINARLKAGAMVPDLAIKLLNEVRRS 307 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+SACSRESNLEE Sbjct: 308 GLRPDIITYNTLISACSRESNLEE 331 >KJB18402.1 hypothetical protein B456_003G050800 [Gossypium raimondii] Length = 1431 Score = 144 bits (362), Expect = 4e-38 Identities = 70/84 (83%), Positives = 79/84 (94%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRF KVQE+LD+MR+RGCEPDLVSFNTLINAR+K+ AMVP LA++LLNE+R S Sbjct: 248 MGVYARNGRFQKVQELLDLMRKRGCEPDLVSFNTLINARLKAGAMVPDLAIKLLNEVRRS 307 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+SACSRESNLEE Sbjct: 308 GLRPDIITYNTLISACSRESNLEE 331 >XP_017622895.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Gossypium arboreum] Length = 1460 Score = 144 bits (362), Expect = 4e-38 Identities = 70/84 (83%), Positives = 79/84 (94%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRF KVQE+LD+MR+RGCEPDLVSFNTLINAR+K+ AMVP LA++LLNE+R S Sbjct: 248 MGVYARNGRFQKVQELLDLMRKRGCEPDLVSFNTLINARLKAGAMVPDLAIKLLNEVRRS 307 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+SACSRESNLEE Sbjct: 308 GLRPDIITYNTLISACSRESNLEE 331 >XP_016710927.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Gossypium hirsutum] Length = 1460 Score = 144 bits (362), Expect = 4e-38 Identities = 70/84 (83%), Positives = 79/84 (94%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRF KVQE+LD+MR+RGCEPDLVSFNTLINAR+K+ AMVP LA++LLNE+R S Sbjct: 248 MGVYARNGRFQKVQELLDLMRKRGCEPDLVSFNTLINARLKAGAMVPDLAIKLLNEVRRS 307 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+SACSRESNLEE Sbjct: 308 GLRPDIITYNTLISACSRESNLEE 331 >XP_013733140.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Brassica napus] Length = 1460 Score = 144 bits (362), Expect = 4e-38 Identities = 70/84 (83%), Positives = 79/84 (94%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRF KVQE+LD+MR+RGCEPDLVSFNTLINAR+K+ AMVP LA++LLNE+R S Sbjct: 248 MGVYARNGRFQKVQELLDLMRKRGCEPDLVSFNTLINARLKAGAMVPDLAIKLLNEVRRS 307 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+SACSRESNLEE Sbjct: 308 GLRPDIITYNTLISACSRESNLEE 331 >XP_012469966.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Gossypium raimondii] KJB18404.1 hypothetical protein B456_003G050800 [Gossypium raimondii] Length = 1460 Score = 144 bits (362), Expect = 4e-38 Identities = 70/84 (83%), Positives = 79/84 (94%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRF KVQE+LD+MR+RGCEPDLVSFNTLINAR+K+ AMVP LA++LLNE+R S Sbjct: 248 MGVYARNGRFQKVQELLDLMRKRGCEPDLVSFNTLINARLKAGAMVPDLAIKLLNEVRRS 307 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+SACSRESNLEE Sbjct: 308 GLRPDIITYNTLISACSRESNLEE 331 >OMO95208.1 hypothetical protein CCACVL1_05491 [Corchorus capsularis] Length = 1465 Score = 144 bits (362), Expect = 4e-38 Identities = 69/84 (82%), Positives = 79/84 (94%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRF KVQE+LD+MR+RGCEPDLVSFNTLINAR+K+ AM+P LA++LLNE+R S Sbjct: 251 MGVYARNGRFQKVQELLDIMRKRGCEPDLVSFNTLINARLKAGAMLPDLAIELLNEVRRS 310 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+SACSRESNLEE Sbjct: 311 GLRPDIITYNTLISACSRESNLEE 334 >XP_016740946.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Gossypium hirsutum] Length = 1476 Score = 144 bits (362), Expect = 4e-38 Identities = 70/84 (83%), Positives = 79/84 (94%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRF KVQE+LD+MR+RGCEPDLVSFNTLINAR+K+ AMVP LA++LLNE+R S Sbjct: 248 MGVYARNGRFQKVQELLDLMRKRGCEPDLVSFNTLINARLKAGAMVPDLAIKLLNEVRRS 307 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+SACSRESNLEE Sbjct: 308 GLRPDIITYNTLISACSRESNLEE 331 >OMP05352.1 hypothetical protein COLO4_08905 [Corchorus olitorius] Length = 1482 Score = 144 bits (362), Expect = 4e-38 Identities = 69/84 (82%), Positives = 79/84 (94%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRF K+QE+LDVMR+RGCEPDLVSFNTLINAR+K+ AM+P LA++LLNE+R S Sbjct: 255 MGVYARNGRFQKIQELLDVMRKRGCEPDLVSFNTLINARLKARAMLPDLAIELLNEVRRS 314 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+SACSRESNLEE Sbjct: 315 GLRPDIITYNTLISACSRESNLEE 338 >XP_008245022.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Prunus mume] Length = 1503 Score = 144 bits (362), Expect = 4e-38 Identities = 70/84 (83%), Positives = 77/84 (91%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRFNKVQE+LD+MRERGCEPDLVS NTLINAR++S AMVP LA+ LLNE+R S Sbjct: 280 MGVYARNGRFNKVQELLDLMRERGCEPDLVSLNTLINARLRSGAMVPNLAIDLLNEVRRS 339 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+S CSRESNLEE Sbjct: 340 GLRPDIITYNTLISGCSRESNLEE 363 >XP_008233573.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Prunus mume] XP_016646765.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Prunus mume] XP_016646766.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Prunus mume] XP_016646767.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Prunus mume] XP_016646768.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Prunus mume] XP_016646769.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Prunus mume] XP_016646770.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Prunus mume] Length = 1503 Score = 144 bits (362), Expect = 4e-38 Identities = 70/84 (83%), Positives = 77/84 (91%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRFNKVQE+LD+MRERGCEPDLVS NTLINAR++S AMVP LA+ LLNE+R S Sbjct: 280 MGVYARNGRFNKVQELLDLMRERGCEPDLVSLNTLINARLRSGAMVPNLAIDLLNEVRRS 339 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+S CSRESNLEE Sbjct: 340 GLRPDIITYNTLISGCSRESNLEE 363 >XP_015964595.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Arachis duranensis] Length = 1509 Score = 143 bits (361), Expect = 5e-38 Identities = 70/84 (83%), Positives = 78/84 (92%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRFNKV+E+LD+MR+RGCEPDLVSFNTLINAR+KS AMVP LA QLL E+R S Sbjct: 275 MGVYARNGRFNKVKELLDLMRKRGCEPDLVSFNTLINARMKSGAMVPNLAFQLLEEVRRS 334 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 G+ PDIITYNTL+SACSRESNLEE Sbjct: 335 GVRPDIITYNTLISACSRESNLEE 358 >KHN35111.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 1487 Score = 142 bits (358), Expect = 1e-37 Identities = 70/84 (83%), Positives = 78/84 (92%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRF+KV+E+LD+MRERGC PDLVSFNTLINAR+KS AM P LALQLLNE+R S Sbjct: 256 MGVYARNGRFSKVKELLDLMRERGCVPDLVSFNTLINARMKSGAMEPNLALQLLNEVRRS 315 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 G+ PDIITYNTL+SACSRESNLEE Sbjct: 316 GIRPDIITYNTLISACSRESNLEE 339 >XP_006590462.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Glycine max] KRH27784.1 hypothetical protein GLYMA_11G013700 [Glycine max] Length = 1487 Score = 142 bits (358), Expect = 1e-37 Identities = 70/84 (83%), Positives = 78/84 (92%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRF+KV+E+LD+MRERGC PDLVSFNTLINAR+KS AM P LALQLLNE+R S Sbjct: 256 MGVYARNGRFSKVKELLDLMRERGCVPDLVSFNTLINARMKSGAMEPNLALQLLNEVRRS 315 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 G+ PDIITYNTL+SACSRESNLEE Sbjct: 316 GIRPDIITYNTLISACSRESNLEE 339 >XP_007206704.1 hypothetical protein PRUPE_ppa023974mg [Prunus persica] Length = 1353 Score = 142 bits (357), Expect = 2e-37 Identities = 69/84 (82%), Positives = 77/84 (91%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRFNKVQE+L++MRERGCEPDLVS NTLINAR++S AMVP LA+ LLNE+R S Sbjct: 121 MGVYARNGRFNKVQELLNLMRERGCEPDLVSLNTLINARLRSGAMVPNLAIDLLNEVRRS 180 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+S CSRESNLEE Sbjct: 181 GLRPDIITYNTLISGCSRESNLEE 204 >EEF42321.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1429 Score = 142 bits (357), Expect = 2e-37 Identities = 69/84 (82%), Positives = 77/84 (91%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYAR GRFNKVQ MLD+MRERGCEPDLVSFNTLINAR+K+ AM P +A++LLNE+R S Sbjct: 217 MGVYARTGRFNKVQGMLDLMRERGCEPDLVSFNTLINARLKAGAMTPNVAIELLNEVRRS 276 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+SACSRESNLEE Sbjct: 277 GLRPDIITYNTLISACSRESNLEE 300 >XP_015575189.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Ricinus communis] Length = 1477 Score = 142 bits (357), Expect = 2e-37 Identities = 69/84 (82%), Positives = 77/84 (91%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYAR GRFNKVQ MLD+MRERGCEPDLVSFNTLINAR+K+ AM P +A++LLNE+R S Sbjct: 254 MGVYARTGRFNKVQGMLDLMRERGCEPDLVSFNTLINARLKAGAMTPNVAIELLNEVRRS 313 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+SACSRESNLEE Sbjct: 314 GLRPDIITYNTLISACSRESNLEE 337 >ONI02054.1 hypothetical protein PRUPE_6G174500 [Prunus persica] Length = 1503 Score = 142 bits (357), Expect = 2e-37 Identities = 69/84 (82%), Positives = 77/84 (91%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRFNKVQE+L++MRERGCEPDLVS NTLINAR++S AMVP LA+ LLNE+R S Sbjct: 280 MGVYARNGRFNKVQELLNLMRERGCEPDLVSLNTLINARLRSGAMVPNLAIDLLNEVRRS 339 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+S CSRESNLEE Sbjct: 340 GLRPDIITYNTLISGCSRESNLEE 363 >XP_007029499.2 PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic [Theobroma cacao] Length = 1458 Score = 141 bits (356), Expect = 2e-37 Identities = 68/84 (80%), Positives = 78/84 (92%) Frame = -2 Query: 254 MGVYARNGRFNKVQEMLDVMRERGCEPDLVSFNTLINARVKSCAMVPGLALQLLNEMRDS 75 MGVYARNGRF KVQE+LD+MRERGCEPDLVSFNTLINA++K+ AM+P L ++LLNE+R S Sbjct: 251 MGVYARNGRFQKVQELLDLMRERGCEPDLVSFNTLINAKLKAGAMLPDLGVELLNEVRRS 310 Query: 74 GLMPDIITYNTLLSACSRESNLEE 3 GL PDIITYNTL+SACSRESNLEE Sbjct: 311 GLRPDIITYNTLISACSRESNLEE 334