BLASTX nr result
ID: Glycyrrhiza28_contig00028057
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00028057 (260 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN03692.1 Translation initiation factor eIF-2B subunit delta [G... 129 4e-34 XP_006582052.1 PREDICTED: translation initiation factor eIF-2B s... 129 4e-34 XP_012575117.1 PREDICTED: translation initiation factor eIF-2B s... 127 2e-33 XP_003527132.1 PREDICTED: translation initiation factor eIF-2B s... 129 3e-33 KRH54799.1 hypothetical protein GLYMA_06G209700 [Glycine max] 129 3e-33 XP_004488360.1 PREDICTED: translation initiation factor eIF-2B s... 127 3e-32 XP_012575113.1 PREDICTED: translation initiation factor eIF-2B s... 127 3e-32 XP_019417436.1 PREDICTED: translation initiation factor eIF-2B s... 126 5e-32 XP_016180589.1 PREDICTED: translation initiation factor eIF-2B s... 125 6e-32 XP_016180588.1 PREDICTED: translation initiation factor eIF-2B s... 125 7e-32 XP_016180587.1 PREDICTED: translation initiation factor eIF-2B s... 125 7e-32 XP_016180586.1 PREDICTED: translation initiation factor eIF-2B s... 125 7e-32 XP_013463966.1 translation initiation factor eIF-2B delta subuni... 122 1e-31 XP_015945860.1 PREDICTED: translation initiation factor eIF-2B s... 125 1e-31 XP_015945859.1 PREDICTED: translation initiation factor eIF-2B s... 125 1e-31 XP_015945858.1 PREDICTED: translation initiation factor eIF-2B s... 125 1e-31 XP_015945857.1 PREDICTED: translation initiation factor eIF-2B s... 125 1e-31 XP_013463965.1 translation initiation factor eIF-2B delta subuni... 122 1e-31 XP_013463967.1 translation initiation factor eIF-2B delta subuni... 122 3e-31 XP_013463964.1 translation initiation factor eIF-2B delta subuni... 122 4e-31 >KHN03692.1 Translation initiation factor eIF-2B subunit delta [Glycine soja] Length = 419 Score = 129 bits (325), Expect = 4e-34 Identities = 69/79 (87%), Positives = 70/79 (88%) Frame = +2 Query: 23 AVGLVGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFF 202 AV VG+RYLAG D SG NARCIEMLRAFQEAIIDYSTPP KVL RDLTAKISSYVSFF Sbjct: 98 AVFKVGMRYLAG--DISGSNARCIEMLRAFQEAIIDYSTPPGKVLVRDLTAKISSYVSFF 155 Query: 203 SECRPLSIGMGNAIRFVKS 259 SECRPLSI MGNAIRFVKS Sbjct: 156 SECRPLSISMGNAIRFVKS 174 >XP_006582052.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X2 [Glycine max] Length = 419 Score = 129 bits (325), Expect = 4e-34 Identities = 69/79 (87%), Positives = 70/79 (88%) Frame = +2 Query: 23 AVGLVGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFF 202 AV VG+RYLAG D SG NARCIEMLRAFQEAIIDYSTPP KVL RDLTAKISSYVSFF Sbjct: 98 AVFKVGMRYLAG--DISGSNARCIEMLRAFQEAIIDYSTPPGKVLVRDLTAKISSYVSFF 155 Query: 203 SECRPLSIGMGNAIRFVKS 259 SECRPLSI MGNAIRFVKS Sbjct: 156 SECRPLSISMGNAIRFVKS 174 >XP_012575117.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X3 [Cicer arietinum] Length = 380 Score = 127 bits (318), Expect = 2e-33 Identities = 65/79 (82%), Positives = 69/79 (87%) Frame = +2 Query: 23 AVGLVGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFF 202 AV VGLRY+AG D SGVNARCIEMLRA QEAIIDYSTPP+KV +RDLT KISSY+SF Sbjct: 58 AVFKVGLRYMAG--DISGVNARCIEMLRALQEAIIDYSTPPEKVFFRDLTTKISSYISFI 115 Query: 203 SECRPLSIGMGNAIRFVKS 259 SECRPLSI MGNAIRFVKS Sbjct: 116 SECRPLSISMGNAIRFVKS 134 >XP_003527132.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X1 [Glycine max] Length = 624 Score = 129 bits (325), Expect = 3e-33 Identities = 69/79 (87%), Positives = 70/79 (88%) Frame = +2 Query: 23 AVGLVGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFF 202 AV VG+RYLAG D SG NARCIEMLRAFQEAIIDYSTPP KVL RDLTAKISSYVSFF Sbjct: 303 AVFKVGMRYLAG--DISGSNARCIEMLRAFQEAIIDYSTPPGKVLVRDLTAKISSYVSFF 360 Query: 203 SECRPLSIGMGNAIRFVKS 259 SECRPLSI MGNAIRFVKS Sbjct: 361 SECRPLSISMGNAIRFVKS 379 >KRH54799.1 hypothetical protein GLYMA_06G209700 [Glycine max] Length = 682 Score = 129 bits (325), Expect = 3e-33 Identities = 69/79 (87%), Positives = 70/79 (88%) Frame = +2 Query: 23 AVGLVGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFF 202 AV VG+RYLAG D SG NARCIEMLRAFQEAIIDYSTPP KVL RDLTAKISSYVSFF Sbjct: 361 AVFKVGMRYLAG--DISGSNARCIEMLRAFQEAIIDYSTPPGKVLVRDLTAKISSYVSFF 418 Query: 203 SECRPLSIGMGNAIRFVKS 259 SECRPLSI MGNAIRFVKS Sbjct: 419 SECRPLSISMGNAIRFVKS 437 >XP_004488360.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X2 [Cicer arietinum] Length = 646 Score = 127 bits (318), Expect = 3e-32 Identities = 65/79 (82%), Positives = 69/79 (87%) Frame = +2 Query: 23 AVGLVGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFF 202 AV VGLRY+AG D SGVNARCIEMLRA QEAIIDYSTPP+KV +RDLT KISSY+SF Sbjct: 324 AVFKVGLRYMAG--DISGVNARCIEMLRALQEAIIDYSTPPEKVFFRDLTTKISSYISFI 381 Query: 203 SECRPLSIGMGNAIRFVKS 259 SECRPLSI MGNAIRFVKS Sbjct: 382 SECRPLSISMGNAIRFVKS 400 >XP_012575113.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X1 [Cicer arietinum] Length = 648 Score = 127 bits (318), Expect = 3e-32 Identities = 65/79 (82%), Positives = 69/79 (87%) Frame = +2 Query: 23 AVGLVGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFF 202 AV VGLRY+AG D SGVNARCIEMLRA QEAIIDYSTPP+KV +RDLT KISSY+SF Sbjct: 326 AVFKVGLRYMAG--DISGVNARCIEMLRALQEAIIDYSTPPEKVFFRDLTTKISSYISFI 383 Query: 203 SECRPLSIGMGNAIRFVKS 259 SECRPLSI MGNAIRFVKS Sbjct: 384 SECRPLSISMGNAIRFVKS 402 >XP_019417436.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like [Lupinus angustifolius] OIV97189.1 hypothetical protein TanjilG_28940 [Lupinus angustifolius] Length = 634 Score = 126 bits (316), Expect = 5e-32 Identities = 67/79 (84%), Positives = 69/79 (87%) Frame = +2 Query: 23 AVGLVGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFF 202 AV VGLRYLAG D SG NARCIEMLRAFQEAI DYSTPP+K L RDLTAKISSYVSFF Sbjct: 313 AVFKVGLRYLAG--DISGSNARCIEMLRAFQEAIGDYSTPPEKALVRDLTAKISSYVSFF 370 Query: 203 SECRPLSIGMGNAIRFVKS 259 +ECRPLSI MGNAIRFVKS Sbjct: 371 TECRPLSISMGNAIRFVKS 389 >XP_016180589.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X4 [Arachis ipaensis] Length = 615 Score = 125 bits (315), Expect = 6e-32 Identities = 65/75 (86%), Positives = 67/75 (89%) Frame = +2 Query: 35 VGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFFSECR 214 VGLRYLAGG TSG NARCIEMLRAFQEAI DYSTPP+K L RDLTAKI SYVSFF+ECR Sbjct: 298 VGLRYLAGG--TSGDNARCIEMLRAFQEAIRDYSTPPEKALVRDLTAKIGSYVSFFTECR 355 Query: 215 PLSIGMGNAIRFVKS 259 PLSI MGNAIRFVKS Sbjct: 356 PLSISMGNAIRFVKS 370 >XP_016180588.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X3 [Arachis ipaensis] Length = 616 Score = 125 bits (315), Expect = 7e-32 Identities = 65/75 (86%), Positives = 67/75 (89%) Frame = +2 Query: 35 VGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFFSECR 214 VGLRYLAGG TSG NARCIEMLRAFQEAI DYSTPP+K L RDLTAKI SYVSFF+ECR Sbjct: 299 VGLRYLAGG--TSGDNARCIEMLRAFQEAIRDYSTPPEKALVRDLTAKIGSYVSFFTECR 356 Query: 215 PLSIGMGNAIRFVKS 259 PLSI MGNAIRFVKS Sbjct: 357 PLSISMGNAIRFVKS 371 >XP_016180587.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X2 [Arachis ipaensis] Length = 620 Score = 125 bits (315), Expect = 7e-32 Identities = 65/75 (86%), Positives = 67/75 (89%) Frame = +2 Query: 35 VGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFFSECR 214 VGLRYLAGG TSG NARCIEMLRAFQEAI DYSTPP+K L RDLTAKI SYVSFF+ECR Sbjct: 303 VGLRYLAGG--TSGDNARCIEMLRAFQEAIRDYSTPPEKALVRDLTAKIGSYVSFFTECR 360 Query: 215 PLSIGMGNAIRFVKS 259 PLSI MGNAIRFVKS Sbjct: 361 PLSISMGNAIRFVKS 375 >XP_016180586.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X1 [Arachis ipaensis] Length = 621 Score = 125 bits (315), Expect = 7e-32 Identities = 65/75 (86%), Positives = 67/75 (89%) Frame = +2 Query: 35 VGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFFSECR 214 VGLRYLAGG TSG NARCIEMLRAFQEAI DYSTPP+K L RDLTAKI SYVSFF+ECR Sbjct: 304 VGLRYLAGG--TSGDNARCIEMLRAFQEAIRDYSTPPEKALVRDLTAKIGSYVSFFTECR 361 Query: 215 PLSIGMGNAIRFVKS 259 PLSI MGNAIRFVKS Sbjct: 362 PLSISMGNAIRFVKS 376 >XP_013463966.1 translation initiation factor eIF-2B delta subunit [Medicago truncatula] KEH38001.1 translation initiation factor eIF-2B delta subunit [Medicago truncatula] Length = 362 Score = 122 bits (306), Expect = 1e-31 Identities = 63/78 (80%), Positives = 68/78 (87%) Frame = +2 Query: 23 AVGLVGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFF 202 AV VGLRY+AG D SGVNARC EMLRA QEAIIDYSTPP+KVL R+LTAKISSY+SF Sbjct: 58 AVFKVGLRYMAG--DISGVNARCTEMLRALQEAIIDYSTPPEKVLIRELTAKISSYISFI 115 Query: 203 SECRPLSIGMGNAIRFVK 256 +ECRPLSI MGNAIRFVK Sbjct: 116 NECRPLSISMGNAIRFVK 133 >XP_015945860.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X4 [Arachis duranensis] Length = 615 Score = 125 bits (313), Expect = 1e-31 Identities = 64/75 (85%), Positives = 67/75 (89%) Frame = +2 Query: 35 VGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFFSECR 214 VGLRYLAGG TSG NARCIEMLRAFQEAI DYSTPP+K L RDLTAK+ SYVSFF+ECR Sbjct: 298 VGLRYLAGG--TSGDNARCIEMLRAFQEAIRDYSTPPEKALVRDLTAKLGSYVSFFTECR 355 Query: 215 PLSIGMGNAIRFVKS 259 PLSI MGNAIRFVKS Sbjct: 356 PLSISMGNAIRFVKS 370 >XP_015945859.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X3 [Arachis duranensis] Length = 616 Score = 125 bits (313), Expect = 1e-31 Identities = 64/75 (85%), Positives = 67/75 (89%) Frame = +2 Query: 35 VGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFFSECR 214 VGLRYLAGG TSG NARCIEMLRAFQEAI DYSTPP+K L RDLTAK+ SYVSFF+ECR Sbjct: 299 VGLRYLAGG--TSGDNARCIEMLRAFQEAIRDYSTPPEKALVRDLTAKLGSYVSFFTECR 356 Query: 215 PLSIGMGNAIRFVKS 259 PLSI MGNAIRFVKS Sbjct: 357 PLSISMGNAIRFVKS 371 >XP_015945858.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X2 [Arachis duranensis] Length = 620 Score = 125 bits (313), Expect = 1e-31 Identities = 64/75 (85%), Positives = 67/75 (89%) Frame = +2 Query: 35 VGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFFSECR 214 VGLRYLAGG TSG NARCIEMLRAFQEAI DYSTPP+K L RDLTAK+ SYVSFF+ECR Sbjct: 303 VGLRYLAGG--TSGDNARCIEMLRAFQEAIRDYSTPPEKALVRDLTAKLGSYVSFFTECR 360 Query: 215 PLSIGMGNAIRFVKS 259 PLSI MGNAIRFVKS Sbjct: 361 PLSISMGNAIRFVKS 375 >XP_015945857.1 PREDICTED: translation initiation factor eIF-2B subunit delta-like isoform X1 [Arachis duranensis] Length = 621 Score = 125 bits (313), Expect = 1e-31 Identities = 64/75 (85%), Positives = 67/75 (89%) Frame = +2 Query: 35 VGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFFSECR 214 VGLRYLAGG TSG NARCIEMLRAFQEAI DYSTPP+K L RDLTAK+ SYVSFF+ECR Sbjct: 304 VGLRYLAGG--TSGDNARCIEMLRAFQEAIRDYSTPPEKALVRDLTAKLGSYVSFFTECR 361 Query: 215 PLSIGMGNAIRFVKS 259 PLSI MGNAIRFVKS Sbjct: 362 PLSISMGNAIRFVKS 376 >XP_013463965.1 translation initiation factor eIF-2B delta subunit [Medicago truncatula] KEH38000.1 translation initiation factor eIF-2B delta subunit [Medicago truncatula] Length = 380 Score = 122 bits (306), Expect = 1e-31 Identities = 63/78 (80%), Positives = 68/78 (87%) Frame = +2 Query: 23 AVGLVGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFF 202 AV VGLRY+AG D SGVNARC EMLRA QEAIIDYSTPP+KVL R+LTAKISSY+SF Sbjct: 58 AVFKVGLRYMAG--DISGVNARCTEMLRALQEAIIDYSTPPEKVLIRELTAKISSYISFI 115 Query: 203 SECRPLSIGMGNAIRFVK 256 +ECRPLSI MGNAIRFVK Sbjct: 116 NECRPLSISMGNAIRFVK 133 >XP_013463967.1 translation initiation factor eIF-2B delta subunit [Medicago truncatula] KEH38002.1 translation initiation factor eIF-2B delta subunit [Medicago truncatula] Length = 439 Score = 122 bits (306), Expect = 3e-31 Identities = 63/78 (80%), Positives = 68/78 (87%) Frame = +2 Query: 23 AVGLVGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFF 202 AV VGLRY+AG D SGVNARC EMLRA QEAIIDYSTPP+KVL R+LTAKISSY+SF Sbjct: 135 AVFKVGLRYMAG--DISGVNARCTEMLRALQEAIIDYSTPPEKVLIRELTAKISSYISFI 192 Query: 203 SECRPLSIGMGNAIRFVK 256 +ECRPLSI MGNAIRFVK Sbjct: 193 NECRPLSISMGNAIRFVK 210 >XP_013463964.1 translation initiation factor eIF-2B delta subunit [Medicago truncatula] KEH37999.1 translation initiation factor eIF-2B delta subunit [Medicago truncatula] Length = 457 Score = 122 bits (306), Expect = 4e-31 Identities = 63/78 (80%), Positives = 68/78 (87%) Frame = +2 Query: 23 AVGLVGLRYLAGGGDTSGVNARCIEMLRAFQEAIIDYSTPPQKVLYRDLTAKISSYVSFF 202 AV VGLRY+AG D SGVNARC EMLRA QEAIIDYSTPP+KVL R+LTAKISSY+SF Sbjct: 135 AVFKVGLRYMAG--DISGVNARCTEMLRALQEAIIDYSTPPEKVLIRELTAKISSYISFI 192 Query: 203 SECRPLSIGMGNAIRFVK 256 +ECRPLSI MGNAIRFVK Sbjct: 193 NECRPLSISMGNAIRFVK 210