BLASTX nr result
ID: Glycyrrhiza28_contig00027943
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00027943 (326 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19220.1 hypothetical protein TSUD_199020 [Trifolium subterran... 59 8e-08 >GAU19220.1 hypothetical protein TSUD_199020 [Trifolium subterraneum] Length = 314 Score = 58.5 bits (140), Expect = 8e-08 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 195 RNDLPSWNSSPPTPEARMAYYRSVRSCPLG 284 RNDLPSWNSSPPTPE AYYRSVRSCPLG Sbjct: 174 RNDLPSWNSSPPTPE---AYYRSVRSCPLG 200