BLASTX nr result
ID: Glycyrrhiza28_contig00027861
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00027861 (462 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_074132415.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp.... 62 9e-09 WP_050403741.1 2-keto-4-pentenoate hydratase [Bradyrhizobium emb... 62 9e-09 WP_038384249.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elk... 62 9e-09 WP_024581217.1 MULTISPECIES: 2-keto-4-pentenoate hydratase [Brad... 62 9e-09 ERF80393.1 3-hydroxybutyryl-CoA dehydratase [Bradyrhizobium sp. ... 62 1e-08 WP_076827590.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp.... 61 2e-08 SDE61061.1 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-di... 61 2e-08 WP_066502639.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp.... 61 2e-08 WP_057015462.1 2-keto-4-pentenoate hydratase [Bradyrhizobium pac... 61 2e-08 WP_050628498.1 2-keto-4-pentenoate hydratase [Bradyrhizobium vir... 61 2e-08 WP_050384255.1 2-keto-4-pentenoate hydratase [Bradyrhizobium pac... 61 2e-08 WP_028332984.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elk... 61 2e-08 WP_076864985.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp.... 61 3e-08 SEE02279.1 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-di... 61 3e-08 WP_018269753.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elk... 60 6e-08 WP_028341136.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elk... 60 9e-08 WP_065753549.1 2-keto-4-pentenoate hydratase [Bradyrhizobium pax... 58 3e-07 WP_057841465.1 2-keto-4-pentenoate hydratase [Bradyrhizobium ret... 58 3e-07 WP_028350412.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elk... 58 3e-07 WP_027580130.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp.... 58 4e-07 >WP_074132415.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp. NAS96.2] OKO67243.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp. NAS96.2] Length = 261 Score = 62.4 bits (150), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV Sbjct: 232 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 261 >WP_050403741.1 2-keto-4-pentenoate hydratase [Bradyrhizobium embrapense] Length = 261 Score = 62.4 bits (150), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV Sbjct: 232 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 261 >WP_038384249.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elkanii] Length = 261 Score = 62.4 bits (150), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV Sbjct: 232 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 261 >WP_024581217.1 MULTISPECIES: 2-keto-4-pentenoate hydratase [Bradyrhizobium] KIU49266.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elkanii] OCX28286.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp. UASWS1016] Length = 261 Score = 62.4 bits (150), Expect = 9e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV Sbjct: 232 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 261 >ERF80393.1 3-hydroxybutyryl-CoA dehydratase [Bradyrhizobium sp. DFCI-1] Length = 265 Score = 62.4 bits (150), Expect = 1e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV Sbjct: 236 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 265 >WP_076827590.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp. UFLA 03-321] OMI10205.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp. UFLA 03-321] Length = 261 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFV+EKV Sbjct: 232 ASPDLKDGDVVEIDITGIGTLRNRFVREKV 261 >SDE61061.1 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Bradyrhizobium sp. R5] Length = 261 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFV+EKV Sbjct: 232 ASPDLKDGDVVEIDITGIGTLRNRFVREKV 261 >WP_066502639.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp. BR 10303] KWV59006.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp. BR 10303] Length = 261 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFV+EKV Sbjct: 232 ASPDLKDGDVVEIDITGIGTLRNRFVREKV 261 >WP_057015462.1 2-keto-4-pentenoate hydratase [Bradyrhizobium pachyrhizi] KRQ12506.1 2-keto-4-pentenoate hydratase [Bradyrhizobium pachyrhizi] Length = 261 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFV+EKV Sbjct: 232 ASPDLKDGDVVEIDITGIGTLRNRFVREKV 261 >WP_050628498.1 2-keto-4-pentenoate hydratase [Bradyrhizobium viridifuturi] Length = 261 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFVKEK+ Sbjct: 232 ASPDLKDGDVVEIDITGIGTLRNRFVKEKM 261 >WP_050384255.1 2-keto-4-pentenoate hydratase [Bradyrhizobium pachyrhizi] Length = 261 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFV+EKV Sbjct: 232 ASPDLKDGDVVEIDITGIGTLRNRFVREKV 261 >WP_028332984.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elkanii] Length = 261 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFV+EKV Sbjct: 232 ASPDLKDGDVVEIDITGIGTLRNRFVREKV 261 >WP_076864985.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp. SEMIA 6399] Length = 265 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFV+EKV Sbjct: 236 ASPDLKDGDVVEIDITGIGTLRNRFVREKV 265 >SEE02279.1 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Bradyrhizobium erythrophlei] Length = 265 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRNRFVKEK+ Sbjct: 236 ASPDLKDGDVVEIDITGIGTLRNRFVKEKL 265 >WP_018269753.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elkanii] ODM76574.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elkanii] ODM78666.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elkanii] OIM88732.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elkanii] Length = 261 Score = 60.1 bits (144), Expect = 6e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIG LRNRFVKEKV Sbjct: 232 ASPDLKDGDVVEIDITGIGILRNRFVKEKV 261 >WP_028341136.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elkanii] Length = 261 Score = 59.7 bits (143), Expect = 9e-08 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLKDGDVVEIDITGIGTLRN+FV+EKV Sbjct: 232 ASPDLKDGDVVEIDITGIGTLRNQFVREKV 261 >WP_065753549.1 2-keto-4-pentenoate hydratase [Bradyrhizobium paxllaeri] OCK64231.1 2-keto-4-pentenoate hydratase [Bradyrhizobium paxllaeri] Length = 261 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLK GD+VEIDITGIGTLRNRFVKEKV Sbjct: 232 ASPDLKAGDLVEIDITGIGTLRNRFVKEKV 261 >WP_057841465.1 2-keto-4-pentenoate hydratase [Bradyrhizobium retamae] KRR29936.1 2-keto-4-pentenoate hydratase [Bradyrhizobium retamae] Length = 261 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLK GDVV+IDITGIGTLRNRFVKEKV Sbjct: 232 ASPDLKAGDVVDIDITGIGTLRNRFVKEKV 261 >WP_028350412.1 2-keto-4-pentenoate hydratase [Bradyrhizobium elkanii] Length = 261 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEKV 373 ASPDLK GDVVEIDITGIGTLRNRFV+EKV Sbjct: 232 ASPDLKAGDVVEIDITGIGTLRNRFVREKV 261 >WP_027580130.1 2-keto-4-pentenoate hydratase [Bradyrhizobium sp. Ai1a-2] Length = 261 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -1 Query: 462 ASPDLKDGDVVEIDITGIGTLRNRFVKEK 376 ASPDLK GDVVEIDITGIGTLRNRFVKEK Sbjct: 232 ASPDLKAGDVVEIDITGIGTLRNRFVKEK 260