BLASTX nr result
ID: Glycyrrhiza28_contig00027789
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00027789 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP43867.1 Polygalacturonase inhibitor, partial [Cajanus cajan] 66 2e-12 ACB30360.1 PGIP [Capsicum annuum] 69 8e-12 XP_004493557.1 PREDICTED: polygalacturonase inhibitor-like [Cice... 69 1e-11 XP_019187479.1 PREDICTED: polygalacturonase inhibitor-like [Ipom... 69 1e-11 XP_009130971.1 PREDICTED: polygalacturonase inhibitor 1-like [Br... 67 1e-11 JAU89671.1 Polygalacturonase inhibitor 1, partial [Noccaea caeru... 65 2e-11 XP_019187480.1 PREDICTED: polygalacturonase inhibitor-like [Ipom... 68 2e-11 XP_019464636.1 PREDICTED: polygalacturonase inhibitor 2-like iso... 66 3e-11 CDP10104.1 unnamed protein product [Coffea canephora] 68 3e-11 ABX46563.1 polygalacturonase inhibitor protein 17 [Brassica napus] 67 4e-11 ABX46560.1 polygalacturonase inhibitor protein 14 [Brassica napus] 67 4e-11 ABX46553.1 polygalacturonase inhibitor protein 7 [Brassica napus] 67 4e-11 NP_001312608.1 polygalacturonase inhibitor-like precursor [Nicot... 67 4e-11 AEL89177.1 polygalacturonase inhibiting protein [Brassica olerac... 67 4e-11 ABX46559.1 polygalacturonase inhibitor protein 13 [Brassica napus] 67 4e-11 ABX46556.1 polygalacturonase inhibitor protein 10 [Brassica napus] 67 4e-11 AIA22327.1 polygalacturonase inhibitor protein [Nicotiana tabacum] 67 4e-11 XP_016204943.1 PREDICTED: polygalacturonase inhibitor-like [Arac... 67 4e-11 XP_015969460.1 PREDICTED: polygalacturonase inhibitor-like [Arac... 67 4e-11 XP_019234293.1 PREDICTED: polygalacturonase inhibitor-like [Nico... 67 4e-11 >KYP43867.1 Polygalacturonase inhibitor, partial [Cajanus cajan] Length = 72 Score = 66.2 bits (160), Expect = 2e-12 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSC 212 CG IPQGG+LQRFD YSY HNKCLCG PLP C Sbjct: 33 CGEIPQGGQLQRFDEYSYLHNKCLCGSPLPPC 64 >ACB30360.1 PGIP [Capsicum annuum] Length = 265 Score = 68.9 bits (167), Expect = 8e-12 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGG +QRFD YSYFHNKCLCG PLP CK Sbjct: 233 CGKIPQGGSMQRFDQYSYFHNKCLCGAPLPPCK 265 >XP_004493557.1 PREDICTED: polygalacturonase inhibitor-like [Cicer arietinum] Length = 335 Score = 68.9 bits (167), Expect = 1e-11 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 1/34 (2%) Frame = -1 Query: 307 CGAIPQGGELQ-RFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGGELQ RFD Y+YFHNKCLCGPPLP CK Sbjct: 302 CGKIPQGGELQKRFDEYAYFHNKCLCGPPLPPCK 335 >XP_019187479.1 PREDICTED: polygalacturonase inhibitor-like [Ipomoea nil] Length = 337 Score = 68.9 bits (167), Expect = 1e-11 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSC 212 CG IPQGGELQRFD Y Y HNKCLCGPPLP+C Sbjct: 306 CGEIPQGGELQRFDKYVYLHNKCLCGPPLPAC 337 >XP_009130971.1 PREDICTED: polygalacturonase inhibitor 1-like [Brassica rapa] Length = 205 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGGELQRFD+Y+Y HNKCLCG PL SCK Sbjct: 173 CGRIPQGGELQRFDAYAYLHNKCLCGAPLQSCK 205 >JAU89671.1 Polygalacturonase inhibitor 1, partial [Noccaea caerulescens] Length = 97 Score = 64.7 bits (156), Expect = 2e-11 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IP+GG+LQRFD+Y+Y HNKCLCG PL SCK Sbjct: 65 CGRIPKGGDLQRFDAYAYLHNKCLCGAPLQSCK 97 >XP_019187480.1 PREDICTED: polygalacturonase inhibitor-like [Ipomoea nil] XP_019187481.1 PREDICTED: polygalacturonase inhibitor-like [Ipomoea nil] Length = 336 Score = 68.2 bits (165), Expect = 2e-11 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSC 212 CG IPQGGELQRF+ Y+Y HNKCLCGPPLP+C Sbjct: 305 CGEIPQGGELQRFNKYAYLHNKCLCGPPLPAC 336 >XP_019464636.1 PREDICTED: polygalacturonase inhibitor 2-like isoform X4 [Lupinus angustifolius] Length = 194 Score = 66.2 bits (160), Expect = 3e-11 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGG LQRFD Y+Y HNKCLCG PLPSCK Sbjct: 161 CGEIPQGGNLQRFDVYAYQHNKCLCGSPLPSCK 193 >CDP10104.1 unnamed protein product [Coffea canephora] Length = 334 Score = 67.8 bits (164), Expect = 3e-11 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGG+LQ FDSY+YFHN+CLCG PLP+CK Sbjct: 302 CGQIPQGGKLQSFDSYNYFHNRCLCGAPLPACK 334 >ABX46563.1 polygalacturonase inhibitor protein 17 [Brassica napus] Length = 327 Score = 67.4 bits (163), Expect = 4e-11 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGGELQRFD+Y+Y HNKCLCG PL SCK Sbjct: 295 CGRIPQGGELQRFDAYAYLHNKCLCGAPLQSCK 327 >ABX46560.1 polygalacturonase inhibitor protein 14 [Brassica napus] Length = 327 Score = 67.4 bits (163), Expect = 4e-11 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGGELQRFD+Y+Y HNKCLCG PL SCK Sbjct: 295 CGRIPQGGELQRFDAYAYLHNKCLCGAPLQSCK 327 >ABX46553.1 polygalacturonase inhibitor protein 7 [Brassica napus] Length = 327 Score = 67.4 bits (163), Expect = 4e-11 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGGELQRFD+Y+Y HNKCLCG PL SCK Sbjct: 295 CGRIPQGGELQRFDAYAYLHNKCLCGAPLQSCK 327 >NP_001312608.1 polygalacturonase inhibitor-like precursor [Nicotiana tabacum] XP_009757214.1 PREDICTED: polygalacturonase inhibitor-like [Nicotiana sylvestris] AIC77783.1 polygalacturonase inhibiting protein [Nicotiana tabacum] Length = 329 Score = 67.4 bits (163), Expect = 4e-11 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGG+LQ FD YSYFHNKCLCG PLP CK Sbjct: 297 CGQIPQGGKLQSFDVYSYFHNKCLCGSPLPECK 329 >AEL89177.1 polygalacturonase inhibiting protein [Brassica oleracea var. italica] Length = 330 Score = 67.4 bits (163), Expect = 4e-11 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGGELQRFD+Y+Y HNKCLCG PL SCK Sbjct: 298 CGRIPQGGELQRFDAYAYLHNKCLCGAPLQSCK 330 >ABX46559.1 polygalacturonase inhibitor protein 13 [Brassica napus] Length = 330 Score = 67.4 bits (163), Expect = 4e-11 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGGELQRFD+Y+Y HNKCLCG PL SCK Sbjct: 298 CGRIPQGGELQRFDAYAYLHNKCLCGAPLQSCK 330 >ABX46556.1 polygalacturonase inhibitor protein 10 [Brassica napus] Length = 330 Score = 67.4 bits (163), Expect = 4e-11 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGGELQRFD+Y+Y HNKCLCG PL SCK Sbjct: 298 CGRIPQGGELQRFDAYAYLHNKCLCGAPLQSCK 330 >AIA22327.1 polygalacturonase inhibitor protein [Nicotiana tabacum] Length = 331 Score = 67.4 bits (163), Expect = 4e-11 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGG+LQ FD YSYFHNKCLCG PLP CK Sbjct: 299 CGQIPQGGKLQSFDVYSYFHNKCLCGSPLPECK 331 >XP_016204943.1 PREDICTED: polygalacturonase inhibitor-like [Arachis ipaensis] Length = 332 Score = 67.4 bits (163), Expect = 4e-11 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGG LQRFD+ +YFHNKCLCG PLPSCK Sbjct: 300 CGEIPQGGRLQRFDNTTYFHNKCLCGSPLPSCK 332 >XP_015969460.1 PREDICTED: polygalacturonase inhibitor-like [Arachis duranensis] Length = 332 Score = 67.4 bits (163), Expect = 4e-11 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGG LQRFD+ +YFHNKCLCG PLPSCK Sbjct: 300 CGEIPQGGRLQRFDNTTYFHNKCLCGSPLPSCK 332 >XP_019234293.1 PREDICTED: polygalacturonase inhibitor-like [Nicotiana attenuata] OIT26833.1 polygalacturonase inhibitor [Nicotiana attenuata] Length = 333 Score = 67.4 bits (163), Expect = 4e-11 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -1 Query: 307 CGAIPQGGELQRFDSYSYFHNKCLCGPPLPSCK 209 CG IPQGG+LQ FD YSYFHNKCLCG PLP CK Sbjct: 301 CGQIPQGGKLQSFDVYSYFHNKCLCGSPLPECK 333