BLASTX nr result
ID: Glycyrrhiza28_contig00027610
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00027610 (270 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP47639.1 Putative auxin efflux carrier component 8 [Cajanus ca... 114 2e-28 XP_017417945.1 PREDICTED: auxin efflux carrier component 5 [Vign... 114 2e-28 XP_014497493.1 PREDICTED: putative auxin efflux carrier componen... 114 4e-28 XP_007139738.1 hypothetical protein PHAVU_008G055200g [Phaseolus... 112 7e-28 GAU47046.1 hypothetical protein TSUD_181590 [Trifolium subterran... 110 7e-28 XP_004492828.1 PREDICTED: putative auxin efflux carrier componen... 108 2e-26 XP_019461375.1 PREDICTED: auxin efflux carrier component 5 [Lupi... 108 4e-26 OMO72914.1 Auxin efflux carrier [Corchorus olitorius] 104 4e-26 XP_003624144.1 auxin efflux carrier family transporter [Medicago... 105 2e-25 XP_002279191.1 PREDICTED: auxin efflux carrier component 5 [Viti... 105 3e-25 AIF28448.1 PIN-like protein, partial [Aextoxicon punctatum] 100 4e-25 XP_010111063.1 Putative auxin efflux carrier component 8 [Morus ... 104 4e-25 OMO60062.1 Auxin efflux carrier [Corchorus capsularis] 104 5e-25 XP_010038273.1 PREDICTED: auxin efflux carrier component 5 [Euca... 104 6e-25 JAU96811.1 Putative auxin efflux carrier component 8, partial [N... 101 8e-25 XP_017976286.1 PREDICTED: auxin efflux carrier component 5 [Theo... 103 1e-24 EOY09902.1 Auxin efflux carrier component [Theobroma cacao] 103 1e-24 JAU30987.1 Putative auxin efflux carrier component 8, partial [N... 101 3e-24 GAV86944.1 Mem_trans domain-containing protein [Cephalotus folli... 102 3e-24 NP_001276122.1 uncharacterized protein LOC100788225 [Glycine max... 102 6e-24 >KYP47639.1 Putative auxin efflux carrier component 8 [Cajanus cajan] Length = 368 Score = 114 bits (285), Expect = 2e-28 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 +KGSFCW ITSFSLCTLTNALVVGVPMVKPMYGA+G DLVVQSSVVQAIIWLTLLLFVLE Sbjct: 94 TKGSFCWSITSFSLCTLTNALVVGVPMVKPMYGALGEDLVVQSSVVQAIIWLTLLLFVLE 153 >XP_017417945.1 PREDICTED: auxin efflux carrier component 5 [Vigna angularis] KOM37029.1 hypothetical protein LR48_Vigan03g041000 [Vigna angularis] BAT83539.1 hypothetical protein VIGAN_04070100 [Vigna angularis var. angularis] Length = 382 Score = 114 bits (285), Expect = 2e-28 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 +KGSFCW ITSFSLCTLTNALVVGVPMVKPMYGA+G DLVVQSSVVQAIIWLTLLLFVLE Sbjct: 94 AKGSFCWSITSFSLCTLTNALVVGVPMVKPMYGALGEDLVVQSSVVQAIIWLTLLLFVLE 153 >XP_014497493.1 PREDICTED: putative auxin efflux carrier component 8 [Vigna radiata var. radiata] Length = 406 Score = 114 bits (284), Expect = 4e-28 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 +KGSFCW ITSFSLCTLTNALVVG+PMVKPMYGA+G DLVVQSSVVQAIIWLTLLLFVLE Sbjct: 119 AKGSFCWSITSFSLCTLTNALVVGIPMVKPMYGALGEDLVVQSSVVQAIIWLTLLLFVLE 178 >XP_007139738.1 hypothetical protein PHAVU_008G055200g [Phaseolus vulgaris] ESW11732.1 hypothetical protein PHAVU_008G055200g [Phaseolus vulgaris] Length = 378 Score = 112 bits (281), Expect = 7e-28 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 +KGSFCW ITSFSLCTLTNALVVGVPMVKPMYGA+G DLVVQSSVVQAIIWLT LLFVLE Sbjct: 93 TKGSFCWSITSFSLCTLTNALVVGVPMVKPMYGALGEDLVVQSSVVQAIIWLTFLLFVLE 152 >GAU47046.1 hypothetical protein TSUD_181590 [Trifolium subterraneum] Length = 268 Score = 110 bits (275), Expect = 7e-28 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 SKGS+ W ITSFSLCTLTN+LVVG+PMVKPMYGAMGVDLVVQ+SVVQAIIWLTLLLFVLE Sbjct: 94 SKGSYQWSITSFSLCTLTNSLVVGIPMVKPMYGAMGVDLVVQASVVQAIIWLTLLLFVLE 153 >XP_004492828.1 PREDICTED: putative auxin efflux carrier component 8 [Cicer arietinum] Length = 366 Score = 108 bits (271), Expect = 2e-26 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = -1 Query: 267 KGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 KGS+CW ITSFSLCTLTN+LVVG+PMVKPMYG MGVDLVVQ+SVVQAI+WLTLLL VLE Sbjct: 95 KGSYCWSITSFSLCTLTNSLVVGIPMVKPMYGPMGVDLVVQASVVQAIVWLTLLLIVLE 153 >XP_019461375.1 PREDICTED: auxin efflux carrier component 5 [Lupinus angustifolius] OIW01139.1 hypothetical protein TanjilG_25247 [Lupinus angustifolius] Length = 382 Score = 108 bits (269), Expect = 4e-26 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 SKGS+CW ITSFSLCTLTNALVVGVPM+K MYG+ VDLVVQSSVVQAIIWLTLLLFVLE Sbjct: 94 SKGSYCWSITSFSLCTLTNALVVGVPMLKAMYGSFAVDLVVQSSVVQAIIWLTLLLFVLE 153 >OMO72914.1 Auxin efflux carrier [Corchorus olitorius] Length = 219 Score = 104 bits (260), Expect = 4e-26 Identities = 51/60 (85%), Positives = 56/60 (93%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 SKGS+CW ITSFSL TLTNALVVGVP++K MYG +GVDLVVQSSV+QAIIWLTLLLFVLE Sbjct: 81 SKGSYCWSITSFSLSTLTNALVVGVPLMKAMYGQVGVDLVVQSSVIQAIIWLTLLLFVLE 140 >XP_003624144.1 auxin efflux carrier family transporter [Medicago truncatula] AAT48629.1 putative auxin efflux carrier protein 9 [Medicago truncatula] ABD28360.1 Auxin Efflux Carrier [Medicago truncatula] AES80362.1 auxin efflux carrier family transporter [Medicago truncatula] Length = 363 Score = 105 bits (263), Expect = 2e-25 Identities = 52/60 (86%), Positives = 56/60 (93%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 SK S+ W ITSFSLCTLTN+LVVG+PMVKPMYG MGVDLVVQ+SVVQAIIWLTLLLFVLE Sbjct: 94 SKVSYSWSITSFSLCTLTNSLVVGIPMVKPMYGPMGVDLVVQASVVQAIIWLTLLLFVLE 153 >XP_002279191.1 PREDICTED: auxin efflux carrier component 5 [Vitis vinifera] CBI17652.3 unnamed protein product, partial [Vitis vinifera] Length = 356 Score = 105 bits (262), Expect = 3e-25 Identities = 51/60 (85%), Positives = 56/60 (93%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 SKGS+CW ITSFSL TLTN+LVVGVP++K MYG +GVDLVVQSSVVQAIIWLTLLLFVLE Sbjct: 94 SKGSYCWSITSFSLATLTNSLVVGVPLIKAMYGPLGVDLVVQSSVVQAIIWLTLLLFVLE 153 >AIF28448.1 PIN-like protein, partial [Aextoxicon punctatum] Length = 163 Score = 100 bits (250), Expect = 4e-25 Identities = 48/60 (80%), Positives = 55/60 (91%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 SKGS+ W ITSFSLCTLTN+LVVGVP++K MYG M VDLVVQ+SVVQAI+WLT+LLFVLE Sbjct: 94 SKGSYTWSITSFSLCTLTNSLVVGVPLMKAMYGQMAVDLVVQASVVQAIVWLTILLFVLE 153 >XP_010111063.1 Putative auxin efflux carrier component 8 [Morus notabilis] EXC29925.1 Putative auxin efflux carrier component 8 [Morus notabilis] Length = 326 Score = 104 bits (260), Expect = 4e-25 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = -1 Query: 267 KGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 KGS+CW ITSFSLCTLTN+LVVGVP++K MYG M VDLVVQSSVVQAIIWLT+LLFVLE Sbjct: 95 KGSYCWSITSFSLCTLTNSLVVGVPLMKAMYGPMAVDLVVQSSVVQAIIWLTILLFVLE 153 >OMO60062.1 Auxin efflux carrier [Corchorus capsularis] Length = 347 Score = 104 bits (260), Expect = 5e-25 Identities = 51/60 (85%), Positives = 56/60 (93%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 SKGS+CW ITSFSL TLTNALVVGVP++K MYG +GVDLVVQSSV+QAIIWLTLLLFVLE Sbjct: 94 SKGSYCWSITSFSLSTLTNALVVGVPLMKAMYGQVGVDLVVQSSVIQAIIWLTLLLFVLE 153 >XP_010038273.1 PREDICTED: auxin efflux carrier component 5 [Eucalyptus grandis] XP_018723703.1 PREDICTED: auxin efflux carrier component 5 [Eucalyptus grandis] KCW84566.1 hypothetical protein EUGRSUZ_B01405 [Eucalyptus grandis] Length = 364 Score = 104 bits (260), Expect = 6e-25 Identities = 48/60 (80%), Positives = 56/60 (93%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 +KGS+CW ITSFSLCTLTN+LVVGVP++K MYG+MGVDLV+Q SV QAI+WLTLLLFVLE Sbjct: 94 TKGSYCWSITSFSLCTLTNSLVVGVPLLKAMYGSMGVDLVIQGSVFQAIVWLTLLLFVLE 153 >JAU96811.1 Putative auxin efflux carrier component 8, partial [Noccaea caerulescens] Length = 212 Score = 101 bits (251), Expect = 8e-25 Identities = 48/60 (80%), Positives = 53/60 (88%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 +KGS+CW ITSFSLCTLTN+LVVGVP+ K MYG VDLVVQSSV QAI+WLTLLLFVLE Sbjct: 28 NKGSYCWSITSFSLCTLTNSLVVGVPLAKAMYGQQAVDLVVQSSVFQAIVWLTLLLFVLE 87 >XP_017976286.1 PREDICTED: auxin efflux carrier component 5 [Theobroma cacao] Length = 353 Score = 103 bits (257), Expect = 1e-24 Identities = 51/60 (85%), Positives = 55/60 (91%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 SKGS+CW ITSFSL TLTNALVVGVP++K MYG GVDLVVQSSVVQAIIWLT+LLFVLE Sbjct: 94 SKGSYCWSITSFSLSTLTNALVVGVPLMKAMYGQTGVDLVVQSSVVQAIIWLTILLFVLE 153 >EOY09902.1 Auxin efflux carrier component [Theobroma cacao] Length = 353 Score = 103 bits (257), Expect = 1e-24 Identities = 51/60 (85%), Positives = 55/60 (91%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 SKGS+CW ITSFSL TLTNALVVGVP++K MYG GVDLVVQSSVVQAIIWLT+LLFVLE Sbjct: 94 SKGSYCWSITSFSLSTLTNALVVGVPLMKAMYGQTGVDLVVQSSVVQAIIWLTILLFVLE 153 >JAU30987.1 Putative auxin efflux carrier component 8, partial [Noccaea caerulescens] Length = 267 Score = 101 bits (251), Expect = 3e-24 Identities = 48/60 (80%), Positives = 53/60 (88%) Frame = -1 Query: 270 SKGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 +KGS+CW ITSFSLCTLTN+LVVGVP+ K MYG VDLVVQSSV QAI+WLTLLLFVLE Sbjct: 94 NKGSYCWSITSFSLCTLTNSLVVGVPLAKAMYGQQAVDLVVQSSVFQAIVWLTLLLFVLE 153 >GAV86944.1 Mem_trans domain-containing protein [Cephalotus follicularis] Length = 342 Score = 102 bits (254), Expect = 3e-24 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = -1 Query: 267 KGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 KGS+CW ITSFSL TLTNALVVGVP+VK MYG M VDLVVQSSV+QAIIWLT+LLFVLE Sbjct: 95 KGSYCWSITSFSLSTLTNALVVGVPLVKAMYGQMAVDLVVQSSVIQAIIWLTVLLFVLE 153 >NP_001276122.1 uncharacterized protein LOC100788225 [Glycine max] AGJ95060.1 PIN9a [Glycine max] Length = 354 Score = 102 bits (253), Expect = 6e-24 Identities = 49/59 (83%), Positives = 53/59 (89%) Frame = -1 Query: 267 KGSFCWFITSFSLCTLTNALVVGVPMVKPMYGAMGVDLVVQSSVVQAIIWLTLLLFVLE 91 KG+F W ITSFSLC LTNALVVGVPMVKPMYGA+GVDLVVQ+SV+QA IW LLLFVLE Sbjct: 95 KGTFSWSITSFSLCNLTNALVVGVPMVKPMYGALGVDLVVQASVIQATIWFPLLLFVLE 153