BLASTX nr result
ID: Glycyrrhiza28_contig00027576
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00027576 (254 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABZ84906.1 hypothetical protein HM1_3148 [Heliobacterium modesti... 52 2e-06 >ABZ84906.1 hypothetical protein HM1_3148 [Heliobacterium modesticaldum Ice1] Length = 113 Score = 51.6 bits (122), Expect = 2e-06 Identities = 26/51 (50%), Positives = 33/51 (64%) Frame = -3 Query: 252 LLGSLILFAPQAFVPQRQLLHRGLPSPLSVPLVSKHFISTPMVLIFSSPIK 100 L G LILFAP AF PQRQ++ R PSPL +S HF +TP + + S +K Sbjct: 34 LPGYLILFAPHAFAPQRQVMSRQSPSPLGFLPISTHFTATPGIPLSSPSLK 84