BLASTX nr result
ID: Glycyrrhiza28_contig00027488
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00027488 (424 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN02849.1 hypothetical protein glysoja_009715 [Glycine soja] 51 5e-06 >KHN02849.1 hypothetical protein glysoja_009715 [Glycine soja] Length = 61 Score = 50.8 bits (120), Expect = 5e-06 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +2 Query: 41 MALSFSNIFCCFSESSGSKGLILVCDGEACMLTDRKKHKGRLKPAKR 181 MALSF + +CCFSESS SK I C+GE CML DRKK+K + +++ Sbjct: 1 MALSFFH-YCCFSESSESKEFI--CEGEVCMLRDRKKYKAKKSKSQK 44