BLASTX nr result
ID: Glycyrrhiza28_contig00027481
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00027481 (655 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004511457.1 PREDICTED: diphthamide biosynthesis protein 1 [Ci... 62 1e-07 GAU18944.1 hypothetical protein TSUD_229340 [Trifolium subterran... 62 1e-07 XP_003610873.2 diphthamide biosynthesis protein [Medicago trunca... 60 5e-07 XP_019444597.1 PREDICTED: diphthamide biosynthesis protein 1 [Lu... 59 8e-07 KHN25439.1 Diphthamide biosynthesis protein 1 [Glycine soja] 59 1e-06 KRH24351.1 hypothetical protein GLYMA_12G035900 [Glycine max] 59 1e-06 BAU00715.1 hypothetical protein VIGAN_10233100 [Vigna angularis ... 59 1e-06 KOM27642.1 hypothetical protein LR48_Vigan442s007800 [Vigna angu... 59 1e-06 XP_016202242.1 PREDICTED: diphthamide biosynthesis protein 1-lik... 58 2e-06 KOM26094.1 hypothetical protein LR48_Vigan230s000500 [Vigna angu... 58 3e-06 XP_014519490.1 PREDICTED: diphthamide biosynthesis protein 1-lik... 58 3e-06 XP_015950233.1 PREDICTED: diphthamide biosynthesis protein 1-lik... 56 9e-06 XP_017405463.1 PREDICTED: diphthamide biosynthesis protein 1-lik... 56 9e-06 >XP_004511457.1 PREDICTED: diphthamide biosynthesis protein 1 [Cicer arietinum] Length = 465 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 655 MDYYAQDGGEWNSSNVKKSSRPARKISVTSI 563 MDYYAQDGGEWNSS VKKS+RPARKISVTS+ Sbjct: 428 MDYYAQDGGEWNSSYVKKSTRPARKISVTSV 458 >GAU18944.1 hypothetical protein TSUD_229340 [Trifolium subterraneum] Length = 469 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 655 MDYYAQDGGEWNSSNVKKSSRPARKISVTSI 563 MDYYAQDGG+WNSS VKKSSRPARKISVTS+ Sbjct: 430 MDYYAQDGGDWNSSYVKKSSRPARKISVTSV 460 >XP_003610873.2 diphthamide biosynthesis protein [Medicago truncatula] AES93831.2 diphthamide biosynthesis protein [Medicago truncatula] Length = 463 Score = 60.1 bits (144), Expect = 5e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 655 MDYYAQDGGEWNSSNVKKSSRPARKISVTSI 563 MDYYAQDGGEWNSS +KK SRPARKISVTS+ Sbjct: 426 MDYYAQDGGEWNSSYMKKPSRPARKISVTSV 456 >XP_019444597.1 PREDICTED: diphthamide biosynthesis protein 1 [Lupinus angustifolius] OIW11137.1 hypothetical protein TanjilG_22944 [Lupinus angustifolius] Length = 461 Score = 59.3 bits (142), Expect = 8e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 655 MDYYAQDGGEWNSSNVKKSSRPARKISVTSI 563 MDYYAQDGG+WNSS VKKS+RPARKISV+S+ Sbjct: 424 MDYYAQDGGDWNSSYVKKSTRPARKISVSSV 454 >KHN25439.1 Diphthamide biosynthesis protein 1 [Glycine soja] Length = 381 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 655 MDYYAQDGGEWNSSNVKKSSRPARKISVTSI 563 MDYYAQDGGEWNSS VKKS+RPAR++SV+S+ Sbjct: 342 MDYYAQDGGEWNSSYVKKSTRPARRVSVSSV 372 >KRH24351.1 hypothetical protein GLYMA_12G035900 [Glycine max] Length = 462 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 655 MDYYAQDGGEWNSSNVKKSSRPARKISVTSI 563 MDYYAQDGGEWNSS VKKS+RPAR++SV+S+ Sbjct: 423 MDYYAQDGGEWNSSYVKKSTRPARRVSVSSV 453 >BAU00715.1 hypothetical protein VIGAN_10233100 [Vigna angularis var. angularis] Length = 470 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 655 MDYYAQDGGEWNSSNVKKSSRPARKISVTSI 563 MDYYAQDGGEWNSS VKKS+RPAR++SV+S+ Sbjct: 431 MDYYAQDGGEWNSSYVKKSTRPARRVSVSSV 461 >KOM27642.1 hypothetical protein LR48_Vigan442s007800 [Vigna angularis] Length = 470 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 655 MDYYAQDGGEWNSSNVKKSSRPARKISVTSI 563 MDYYAQDGGEWNSS VKKS+RPAR++SV+S+ Sbjct: 431 MDYYAQDGGEWNSSYVKKSTRPARRVSVSSV 461 >XP_016202242.1 PREDICTED: diphthamide biosynthesis protein 1-like [Arachis ipaensis] Length = 462 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 655 MDYYAQDGGEWNSSNVKKSSRPARKISVTSI 563 MDYY+QDGGEWNSS VKKSSRP R+ISV+SI Sbjct: 425 MDYYSQDGGEWNSSYVKKSSRPVRRISVSSI 455 >KOM26094.1 hypothetical protein LR48_Vigan230s000500 [Vigna angularis] BAT74353.1 hypothetical protein VIGAN_01200400 [Vigna angularis var. angularis] Length = 470 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 655 MDYYAQDGGEWNSSNVKKSSRPARKISVTS 566 MDYYAQDGGEWNSS VKKS+RPAR++SV+S Sbjct: 431 MDYYAQDGGEWNSSYVKKSTRPARRVSVSS 460 >XP_014519490.1 PREDICTED: diphthamide biosynthesis protein 1-like [Vigna radiata var. radiata] Length = 473 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 655 MDYYAQDGGEWNSSNVKKSSRPARKISVTS 566 MDYYAQDGGEWNSS VKKS+RPAR++SV+S Sbjct: 434 MDYYAQDGGEWNSSYVKKSTRPARRVSVSS 463 >XP_015950233.1 PREDICTED: diphthamide biosynthesis protein 1-like, partial [Arachis duranensis] Length = 451 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 655 MDYYAQDGGEWNSSNVKKSSRPARKISVTSI 563 M+YY+QDGGEWNSS VKKSSRP R+ISV+S+ Sbjct: 412 MEYYSQDGGEWNSSYVKKSSRPVRRISVSSV 442 >XP_017405463.1 PREDICTED: diphthamide biosynthesis protein 1-like isoform X1 [Vigna angularis] XP_017405468.1 PREDICTED: diphthamide biosynthesis protein 1-like isoform X2 [Vigna angularis] Length = 479 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 655 MDYYAQDGGEWNSSNVKKSSRPARKISVTS 566 MDYYAQDGGEWNSS VKKS+RP R++SV+S Sbjct: 431 MDYYAQDGGEWNSSYVKKSTRPVRRVSVSS 460