BLASTX nr result
ID: Glycyrrhiza28_contig00027469
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00027469 (353 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU35933.1 hypothetical protein TSUD_69660 [Trifolium subterraneum] 129 5e-33 XP_013446721.1 PPR containing plant-like protein [Medicago trunc... 124 4e-31 XP_012572260.1 PREDICTED: pentatricopeptide repeat-containing pr... 119 4e-29 XP_016190712.1 PREDICTED: pentatricopeptide repeat-containing pr... 118 8e-29 XP_015957645.1 PREDICTED: pentatricopeptide repeat-containing pr... 118 8e-29 XP_019463802.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 2e-27 XP_018851251.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 8e-27 XP_015581397.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 1e-26 XP_015581394.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 1e-26 EEF32352.1 pentatricopeptide repeat-containing protein, putative... 112 1e-26 KDO37945.1 hypothetical protein CISIN_1g0434802mg, partial [Citr... 103 3e-26 XP_012085508.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 5e-26 XP_010100361.1 hypothetical protein L484_027670 [Morus notabilis... 107 9e-25 XP_009359234.1 PREDICTED: pentatricopeptide repeat-containing pr... 106 2e-24 XP_008340122.1 PREDICTED: pentatricopeptide repeat-containing pr... 106 2e-24 XP_008221931.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 3e-24 XP_007227261.1 hypothetical protein PRUPE_ppa017811mg [Prunus pe... 105 4e-24 ONI30294.1 hypothetical protein PRUPE_1G242700 [Prunus persica] 105 4e-24 XP_008389736.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 4e-24 XP_003531325.2 PREDICTED: pentatricopeptide repeat-containing pr... 104 6e-24 >GAU35933.1 hypothetical protein TSUD_69660 [Trifolium subterraneum] Length = 519 Score = 129 bits (325), Expect = 5e-33 Identities = 64/69 (92%), Positives = 65/69 (94%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 MY SVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSN R FSIDYNRFIGVLLR+SHL Sbjct: 1 MYHSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNSRPFSIDYNRFIGVLLRNSHL 60 Query: 326 DLAHRYYHR 352 DLAH YYHR Sbjct: 61 DLAHNYYHR 69 >XP_013446721.1 PPR containing plant-like protein [Medicago truncatula] KEH20748.1 PPR containing plant-like protein [Medicago truncatula] Length = 515 Score = 124 bits (311), Expect = 4e-31 Identities = 59/68 (86%), Positives = 63/68 (92%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 MY SV ARRLLYRS ISYYVK+GLIDTAIQ+FDEMSQSNCR+FSIDYNRFIGVLLRHSHL Sbjct: 1 MYHSVAARRLLYRSTISYYVKSGLIDTAIQLFDEMSQSNCRLFSIDYNRFIGVLLRHSHL 60 Query: 326 DLAHRYYH 349 +LA YYH Sbjct: 61 NLAENYYH 68 >XP_012572260.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Cicer arietinum] Length = 516 Score = 119 bits (297), Expect = 4e-29 Identities = 58/69 (84%), Positives = 62/69 (89%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 MY SV ARRLLYRSQISYYVKAGLIDTAI++FDEMSQ+N R FSIDYNRFIGVL+RHSHL Sbjct: 1 MYHSVAARRLLYRSQISYYVKAGLIDTAIKLFDEMSQTNSRPFSIDYNRFIGVLIRHSHL 60 Query: 326 DLAHRYYHR 352 DLA YY R Sbjct: 61 DLAQSYYRR 69 >XP_016190712.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Arachis ipaensis] XP_016190713.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Arachis ipaensis] Length = 525 Score = 118 bits (295), Expect = 8e-29 Identities = 56/68 (82%), Positives = 62/68 (91%) Frame = +2 Query: 143 DMYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSH 322 DMYQSVGARRLLYRSQI++YVKAGLID AI+VFDEM+QSNCR+FS+DYNRFIGVLLR S Sbjct: 9 DMYQSVGARRLLYRSQITHYVKAGLIDNAIKVFDEMTQSNCRLFSLDYNRFIGVLLRQSR 68 Query: 323 LDLAHRYY 346 DLA YY Sbjct: 69 FDLAEHYY 76 >XP_015957645.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Arachis duranensis] Length = 525 Score = 118 bits (295), Expect = 8e-29 Identities = 56/68 (82%), Positives = 62/68 (91%) Frame = +2 Query: 143 DMYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSH 322 DMYQSVGARRLLYRSQI++YVKAGLID AI+VFDEM+QSNCR+FS+DYNRFIGVLLR S Sbjct: 9 DMYQSVGARRLLYRSQITHYVKAGLIDNAIKVFDEMTQSNCRLFSLDYNRFIGVLLRQSR 68 Query: 323 LDLAHRYY 346 DLA YY Sbjct: 69 FDLAEHYY 76 >XP_019463802.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Lupinus angustifolius] Length = 523 Score = 114 bits (285), Expect = 2e-27 Identities = 53/70 (75%), Positives = 62/70 (88%) Frame = +2 Query: 143 DMYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSH 322 DMYQS+GA+RLLYR+QIS YVK GLID AI+VFDEMSQS CR+FS+DYNRFIGVL++ S Sbjct: 7 DMYQSLGAQRLLYRAQISQYVKLGLIDKAIKVFDEMSQSKCRVFSLDYNRFIGVLIKDSR 66 Query: 323 LDLAHRYYHR 352 DLAH YY+R Sbjct: 67 YDLAHHYYYR 76 >XP_018851251.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Juglans regia] Length = 659 Score = 113 bits (282), Expect = 8e-27 Identities = 52/73 (71%), Positives = 64/73 (87%) Frame = +2 Query: 134 TERDMYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLR 313 T DM +S+GARRL+YR++ISY+VKAGLID AIQVFDEM+QS+CRIFSIDYNRF+GVL+R Sbjct: 139 THSDMSRSLGARRLIYRARISYFVKAGLIDQAIQVFDEMTQSDCRIFSIDYNRFVGVLVR 198 Query: 314 HSHLDLAHRYYHR 352 S +LA YYH+ Sbjct: 199 ESRFELAEHYYHK 211 >XP_015581397.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial isoform X2 [Ricinus communis] Length = 519 Score = 112 bits (280), Expect = 1e-26 Identities = 52/67 (77%), Positives = 60/67 (89%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 MYQS+GA RL+YRS+I+ YVKAGLID A+QVFDEMSQSNCR+FSIDYNRFIGVL+ HS Sbjct: 1 MYQSLGAHRLIYRSRIAGYVKAGLIDKAVQVFDEMSQSNCRVFSIDYNRFIGVLINHSRF 60 Query: 326 DLAHRYY 346 DLA+ YY Sbjct: 61 DLANHYY 67 >XP_015581394.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial isoform X1 [Ricinus communis] XP_015581395.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial isoform X1 [Ricinus communis] XP_015581396.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial isoform X1 [Ricinus communis] Length = 529 Score = 112 bits (280), Expect = 1e-26 Identities = 52/67 (77%), Positives = 60/67 (89%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 MYQS+GA RL+YRS+I+ YVKAGLID A+QVFDEMSQSNCR+FSIDYNRFIGVL+ HS Sbjct: 1 MYQSLGAHRLIYRSRIAGYVKAGLIDKAVQVFDEMSQSNCRVFSIDYNRFIGVLINHSRF 60 Query: 326 DLAHRYY 346 DLA+ YY Sbjct: 61 DLANHYY 67 >EEF32352.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 554 Score = 112 bits (280), Expect = 1e-26 Identities = 52/67 (77%), Positives = 60/67 (89%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 MYQS+GA RL+YRS+I+ YVKAGLID A+QVFDEMSQSNCR+FSIDYNRFIGVL+ HS Sbjct: 1 MYQSLGAHRLIYRSRIAGYVKAGLIDKAVQVFDEMSQSNCRVFSIDYNRFIGVLINHSRF 60 Query: 326 DLAHRYY 346 DLA+ YY Sbjct: 61 DLANHYY 67 >KDO37945.1 hypothetical protein CISIN_1g0434802mg, partial [Citrus sinensis] Length = 108 Score = 103 bits (256), Expect = 3e-26 Identities = 48/69 (69%), Positives = 57/69 (82%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 M Q +GA+RL+YR+QIS VKAGLID A+ VFDEM+QSNCR+FSIDYNRFIGVL+RHS Sbjct: 1 MIQKLGAQRLIYRAQISNLVKAGLIDQAVHVFDEMTQSNCRVFSIDYNRFIGVLIRHSRF 60 Query: 326 DLAHRYYHR 352 DL YY + Sbjct: 61 DLVQFYYQQ 69 >XP_012085508.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Jatropha curcas] XP_012085509.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Jatropha curcas] XP_012085510.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Jatropha curcas] KDP26677.1 hypothetical protein JCGZ_17835 [Jatropha curcas] Length = 517 Score = 110 bits (275), Expect = 5e-26 Identities = 50/69 (72%), Positives = 59/69 (85%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 MY S+GA RL+YRS+I+ YVK GLID AIQVFDEM+QSNCR+FSIDYNRFIG+L+ HS Sbjct: 1 MYHSLGAHRLIYRSRIAGYVKLGLIDKAIQVFDEMTQSNCRVFSIDYNRFIGILIHHSRF 60 Query: 326 DLAHRYYHR 352 DLAH YY + Sbjct: 61 DLAHHYYSK 69 >XP_010100361.1 hypothetical protein L484_027670 [Morus notabilis] EXB82495.1 hypothetical protein L484_027670 [Morus notabilis] Length = 513 Score = 107 bits (266), Expect = 9e-25 Identities = 49/69 (71%), Positives = 58/69 (84%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 M S+GA RLLYRS+I+Y VK GLID A+Q+FDEMS S+CR+FS+DYNRFIGVL RHS L Sbjct: 1 MIHSLGAHRLLYRSRIAYCVKTGLIDHAVQLFDEMSHSDCRVFSVDYNRFIGVLARHSRL 60 Query: 326 DLAHRYYHR 352 DLA YYH+ Sbjct: 61 DLAEHYYHK 69 >XP_009359234.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Pyrus x bretschneideri] Length = 515 Score = 106 bits (264), Expect = 2e-24 Identities = 46/68 (67%), Positives = 59/68 (86%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 MY+S+G RL+YRS+I+YYVK GLID A+QVFDEM+ S+CR+FS+DYNRFIGVL++HS Sbjct: 1 MYRSLGVHRLIYRSRIAYYVKTGLIDQALQVFDEMTHSDCRVFSVDYNRFIGVLVKHSRY 60 Query: 326 DLAHRYYH 349 DLA YY+ Sbjct: 61 DLAEHYYY 68 >XP_008340122.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Malus domestica] Length = 515 Score = 106 bits (264), Expect = 2e-24 Identities = 46/68 (67%), Positives = 59/68 (86%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 MY+S+G RL+YRS+I+YYVK GLID A+QVFDEM+ S+CR+FS+DYNRFIGVL++HS Sbjct: 1 MYRSLGVHRLIYRSRIAYYVKTGLIDQALQVFDEMTHSDCRVFSVDYNRFIGVLVKHSRY 60 Query: 326 DLAHRYYH 349 DLA YY+ Sbjct: 61 DLAEHYYY 68 >XP_008221931.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Prunus mume] XP_016647292.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Prunus mume] XP_016647293.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Prunus mume] XP_016647294.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial [Prunus mume] Length = 527 Score = 105 bits (262), Expect = 3e-24 Identities = 47/68 (69%), Positives = 59/68 (86%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 MY+S+G RL++RS+I YYVK GLID A+QVFDEM++S+CR+FSIDYNRFIGVL+RHS Sbjct: 1 MYRSLGVNRLIFRSRIVYYVKTGLIDQALQVFDEMTRSDCRVFSIDYNRFIGVLVRHSRY 60 Query: 326 DLAHRYYH 349 DLA YY+ Sbjct: 61 DLAEHYYY 68 >XP_007227261.1 hypothetical protein PRUPE_ppa017811mg [Prunus persica] Length = 541 Score = 105 bits (262), Expect = 4e-24 Identities = 47/68 (69%), Positives = 59/68 (86%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 MY+S+G RL++RS+I YYVK GLID A+QVFDEM++S+CR+FSIDYNRFIGVL+RHS Sbjct: 1 MYRSLGVNRLIFRSRIVYYVKTGLIDQALQVFDEMTRSDCRVFSIDYNRFIGVLVRHSRY 60 Query: 326 DLAHRYYH 349 DLA YY+ Sbjct: 61 DLAEHYYY 68 >ONI30294.1 hypothetical protein PRUPE_1G242700 [Prunus persica] Length = 565 Score = 105 bits (262), Expect = 4e-24 Identities = 47/68 (69%), Positives = 59/68 (86%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 MY+S+G RL++RS+I YYVK GLID A+QVFDEM++S+CR+FSIDYNRFIGVL+RHS Sbjct: 1 MYRSLGVNRLIFRSRIVYYVKTGLIDQALQVFDEMTRSDCRVFSIDYNRFIGVLVRHSRY 60 Query: 326 DLAHRYYH 349 DLA YY+ Sbjct: 61 DLAEHYYY 68 >XP_008389736.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Malus domestica] XP_008389737.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Malus domestica] XP_008389739.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Malus domestica] Length = 515 Score = 105 bits (261), Expect = 4e-24 Identities = 46/68 (67%), Positives = 58/68 (85%) Frame = +2 Query: 146 MYQSVGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSHL 325 MY+S+G RL+YRS+I YYVK GLID A+QVFDEM+ S+CR+FS+DYNRFIGVL++HS Sbjct: 1 MYRSLGVHRLIYRSRIVYYVKTGLIDQALQVFDEMTHSDCRVFSVDYNRFIGVLVKHSRY 60 Query: 326 DLAHRYYH 349 DLA YY+ Sbjct: 61 DLAEHYYY 68 >XP_003531325.2 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Glycine max] XP_006585252.1 PREDICTED: pentatricopeptide repeat-containing protein At1g13040, mitochondrial-like [Glycine max] KRH43104.1 hypothetical protein GLYMA_08G131100 [Glycine max] Length = 521 Score = 104 bits (260), Expect = 6e-24 Identities = 51/70 (72%), Positives = 59/70 (84%), Gaps = 1/70 (1%) Frame = +2 Query: 146 MYQS-VGARRLLYRSQISYYVKAGLIDTAIQVFDEMSQSNCRIFSIDYNRFIGVLLRHSH 322 MYQS +GA RL YRSQIS VKAGLI+ AI +FD+M++SNCR+FS+DYNRFIGVLLRHS Sbjct: 1 MYQSSIGAHRLAYRSQISKLVKAGLINQAIYLFDQMTESNCRVFSVDYNRFIGVLLRHSR 60 Query: 323 LDLAHRYYHR 352 L LAH YY R Sbjct: 61 LHLAHHYYRR 70