BLASTX nr result
ID: Glycyrrhiza28_contig00027307
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00027307 (232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_015929579.1 radical SAM/SPASM domain-containing protein [Meth... 63 2e-10 WP_068184797.1 heme biosynthesis protein [Rhizobiales bacterium ... 55 2e-08 >WP_015929579.1 radical SAM/SPASM domain-containing protein [Methylobacterium nodulans] ACL57904.1 Radical SAM domain protein [Methylobacterium nodulans ORS 2060] Length = 439 Score = 62.8 bits (151), Expect(2) = 2e-10 Identities = 28/45 (62%), Positives = 30/45 (66%) Frame = +3 Query: 78 PLYDGDPRKLARWQTGAHAPPCIAVWELTLRCATAARRQGSRPHR 212 P YDGDPR LARW+ G APP AVWE+TLRC R GSR R Sbjct: 8 PTYDGDPRSLARWRPGGSAPPSHAVWEITLRCDLGCRHCGSRAGR 52 Score = 29.6 bits (65), Expect(2) = 2e-10 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +1 Query: 184 LGVKEVALIGGKFYLR 231 LG++EV LIGG+FYLR Sbjct: 73 LGLREVTLIGGEFYLR 88 >WP_068184797.1 heme biosynthesis protein [Rhizobiales bacterium CCH3-A5] Length = 442 Score = 55.5 bits (132), Expect(2) = 2e-08 Identities = 25/45 (55%), Positives = 30/45 (66%) Frame = +3 Query: 78 PLYDGDPRKLARWQTGAHAPPCIAVWELTLRCATAARRQGSRPHR 212 P YDG+P++LARW+ APP IAVWE+TLRC GSR R Sbjct: 5 PTYDGNPQQLARWRPEHDAPPSIAVWEITLRCDLGCCHCGSRAAR 49 Score = 30.0 bits (66), Expect(2) = 2e-08 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +1 Query: 184 LGVKEVALIGGKFYLR 231 LG+KEV LIGG+FY+R Sbjct: 70 LGLKEVTLIGGEFYMR 85