BLASTX nr result
ID: Glycyrrhiza28_contig00027147
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00027147 (491 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP35984.1 hypothetical protein KK1_042921 [Cajanus cajan] 45 7e-07 >KYP35984.1 hypothetical protein KK1_042921 [Cajanus cajan] Length = 198 Score = 45.1 bits (105), Expect(2) = 7e-07 Identities = 23/36 (63%), Positives = 27/36 (75%), Gaps = 2/36 (5%) Frame = +2 Query: 68 IKCGNCRILQCTV--ARSMNCAVGNFVTSVGISIIS 169 + CGNCR+L ARS+ CAV NFVTSVG+SIIS Sbjct: 132 VNCGNCRMLLMYQYGARSVKCAVCNFVTSVGVSIIS 167 Score = 35.4 bits (80), Expect(2) = 7e-07 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +3 Query: 6 KTCFICELNHCDSSPYFCG 62 KTCF CELN D SPYF G Sbjct: 99 KTCFFCELNQYDLSPYFVG 117