BLASTX nr result
ID: Glycyrrhiza28_contig00027076
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00027076 (379 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_004761322.1 transcriptional regulator [Acinetobacter sp. CIP ... 69 5e-12 WP_004679728.1 transcriptional regulator [Acinetobacter parvus] ... 69 5e-12 WP_004682373.1 MULTISPECIES: HxlR family transcriptional regulat... 69 5e-12 WP_016540292.1 transcriptional regulator, HxlR family [Acinetoba... 67 1e-11 WP_005203362.1 MULTISPECIES: transcriptional regulator [Acinetob... 67 1e-11 WP_005315815.1 transcriptional regulator [Acinetobacter sp. ANC ... 67 1e-11 WP_005270784.1 MULTISPECIES: transcriptional regulator [Acinetob... 67 1e-11 WP_005188988.1 transcriptional regulator [Acinetobacter sp. ANC ... 67 1e-11 WP_005152602.1 transcriptional regulator [Acinetobacter sp. ANC ... 67 1e-11 WP_004807462.1 MULTISPECIES: transcriptional regulator [Acinetob... 67 1e-11 WP_004653285.1 MULTISPECIES: transcriptional regulator [Acinetob... 67 1e-11 WP_005241263.1 MULTISPECIES: HxlR family transcriptional regulat... 67 1e-11 WP_004638944.1 HxlR family transcriptional regulator [Acinetobac... 67 3e-11 WP_005080915.1 MULTISPECIES: HxlR family transcriptional regulat... 67 3e-11 WP_061525126.1 HxlR family transcriptional regulator [Acinetobac... 66 4e-11 WP_038344232.1 HxlR family transcriptional regulator [Acinetobac... 66 4e-11 WP_005293683.1 transcriptional regulator [Acinetobacter sp. NIPH... 66 4e-11 WP_005230190.1 MULTISPECIES: transcriptional regulator [Acinetob... 66 4e-11 WP_004879302.1 MULTISPECIES: transcriptional regulator [Acinetob... 66 4e-11 WP_004771974.1 MULTISPECIES: transcriptional regulator [Acinetob... 66 4e-11 >WP_004761322.1 transcriptional regulator [Acinetobacter sp. CIP 102129] ENU86089.1 hypothetical protein F973_01686 [Acinetobacter sp. CIP 102129] Length = 160 Score = 68.6 bits (166), Expect = 5e-12 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + WD++GDQ CSVART+S+LGDRWTML++R AF G FDEF Sbjct: 1 MKWDEIGDQPCSVARTLSVLGDRWTMLILRNAFMGIRRFDEF 42 >WP_004679728.1 transcriptional regulator [Acinetobacter parvus] ENU32978.1 hypothetical protein F989_02029 [Acinetobacter parvus NIPH 1103] Length = 160 Score = 68.6 bits (166), Expect = 5e-12 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + WD++GDQ CSVART+S+LGDRWTML++R AF G FDEF Sbjct: 1 MKWDEIGDQPCSVARTLSVLGDRWTMLILRNAFMGIRRFDEF 42 >WP_004682373.1 MULTISPECIES: HxlR family transcriptional regulator [Acinetobacter] ENU36145.1 hypothetical protein F988_01642 [Acinetobacter parvus DSM 16617 = CIP 108168] ENU82779.1 hypothetical protein F974_02239 [Acinetobacter sp. CIP 102159] ENU89046.1 hypothetical protein F972_01558 [Acinetobacter sp. CIP 102529] ENU96289.1 hypothetical protein F970_00878 [Acinetobacter sp. CIP 102082] ENV05636.1 hypothetical protein F967_01739 [Acinetobacter sp. CIP 102637] ENX62598.1 hypothetical protein F884_02261 [Acinetobacter sp. CIP 102143] Length = 161 Score = 68.6 bits (166), Expect = 5e-12 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + WD++GDQ CSVART+S+LGDRWTML++R AF G FDEF Sbjct: 1 MKWDEIGDQPCSVARTLSVLGDRWTMLILRNAFMGIRRFDEF 42 >WP_016540292.1 transcriptional regulator, HxlR family [Acinetobacter gyllenbergii] EPF87937.1 hypothetical protein F957_01224 [Acinetobacter gyllenbergii CIP 110306] EPH35987.1 Transcriptional regulator, HxlR family [Acinetobacter gyllenbergii MTCC 11365] ESK54826.1 hypothetical protein F987_00672 [Acinetobacter gyllenbergii NIPH 230] OBY73030.1 HxlR family transcriptional regulator [Acinetobacter gyllenbergii] Length = 160 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + WD++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWDEIGDQPCSVARTLSVLGDRWTMLILRNAFMGIRRFDDF 42 >WP_005203362.1 MULTISPECIES: transcriptional regulator [Acinetobacter] ENX57832.1 hypothetical protein F902_02232 [Acinetobacter sp. CIP 70.18] Length = 160 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + WD++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWDEIGDQPCSVARTLSVLGDRWTMLILRNAFMGIRRFDDF 42 >WP_005315815.1 transcriptional regulator [Acinetobacter sp. ANC 3880] ENX57001.1 hypothetical protein F885_03157 [Acinetobacter sp. ANC 3880] Length = 160 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + WD++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWDEIGDQPCSVARTLSVLGDRWTMLILRNAFMGIRRFDDF 42 >WP_005270784.1 MULTISPECIES: transcriptional regulator [Acinetobacter] ENX35208.1 hypothetical protein F889_00875 [Acinetobacter sp. NIPH 1859] EPG37959.1 hypothetical protein F907_01929 [Acinetobacter sp. NIPH 2036] Length = 160 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + WD++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWDEIGDQPCSVARTLSVLGDRWTMLILRNAFMGIRRFDDF 42 >WP_005188988.1 transcriptional regulator [Acinetobacter sp. ANC 4105] ENW92291.1 hypothetical protein F904_02229 [Acinetobacter sp. ANC 4105] Length = 160 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + WD++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWDEIGDQPCSVARTLSVLGDRWTMLILRNAFMGIRRFDDF 42 >WP_005152602.1 transcriptional regulator [Acinetobacter sp. ANC 3929] ENW81027.1 hypothetical protein F909_02318 [Acinetobacter sp. ANC 3929] Length = 160 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + WD++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWDEIGDQPCSVARTLSVLGDRWTMLILRNAFMGIRRFDDF 42 >WP_004807462.1 MULTISPECIES: transcriptional regulator [Acinetobacter] ENV07629.1 hypothetical protein F966_03486 [Acinetobacter sp. CIP 56.2] ENX51551.1 hypothetical protein F901_02739 [Acinetobacter sp. NIPH 1867] EOR07469.1 hypothetical protein F896_01842 [Acinetobacter sp. CIP 110321] Length = 160 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + WD++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWDEIGDQPCSVARTLSVLGDRWTMLILRNAFMGIRRFDDF 42 >WP_004653285.1 MULTISPECIES: transcriptional regulator [Acinetobacter] ENU23872.1 hypothetical protein F993_01188 [Acinetobacter sp. NIPH 809] OEY94752.1 HxlR family transcriptional regulator [Acinetobacter proteolyticus] Length = 160 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + WD++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWDEIGDQPCSVARTLSVLGDRWTMLILRNAFMGIRRFDDF 42 >WP_005241263.1 MULTISPECIES: HxlR family transcriptional regulator [Acinetobacter] ENX15315.1 hypothetical protein F895_01861 [Acinetobacter sp. CIP 64.2] Length = 160 Score = 67.4 bits (163), Expect = 1e-11 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + WD++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWDEIGDQPCSVARTLSVLGDRWTMLILRNAFMGIRRFDDF 42 >WP_004638944.1 HxlR family transcriptional regulator [Acinetobacter haemolyticus] EFF82652.1 transcriptional regulator, HxlR family [Acinetobacter haemolyticus ATCC 19194] Length = 160 Score = 66.6 bits (161), Expect = 3e-11 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + W+++GDQ CSVART+SILGDRWTML++R AF G FD+F Sbjct: 1 MKWEEIGDQPCSVARTLSILGDRWTMLILRNAFMGVRRFDDF 42 >WP_005080915.1 MULTISPECIES: HxlR family transcriptional regulator [Acinetobacter] EEH67530.1 transcriptional regulator, HxlR family [Acinetobacter sp. ATCC 27244] ENW18542.1 hypothetical protein F927_01321 [Acinetobacter haemolyticus CIP 64.3] ENW20008.1 hypothetical protein F926_02106 [Acinetobacter haemolyticus NIPH 261] EPR90305.1 Transcriptional regulator, HxlR family [Acinetobacter haemolyticus MTCC 9819] APR70203.1 transcriptional regulator [Acinetobacter haemolyticus] Length = 160 Score = 66.6 bits (161), Expect = 3e-11 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + W+++GDQ CSVART+SILGDRWTML++R AF G FD+F Sbjct: 1 MKWEEIGDQPCSVARTLSILGDRWTMLILRNAFMGVRRFDDF 42 >WP_061525126.1 HxlR family transcriptional regulator [Acinetobacter venetianus] KXZ69534.1 putative HTH-type transcriptional regulator YybR [Acinetobacter venetianus] Length = 160 Score = 66.2 bits (160), Expect = 4e-11 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + W+++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWEEIGDQPCSVARTLSVLGDRWTMLILRNAFMGVRRFDDF 42 >WP_038344232.1 HxlR family transcriptional regulator [Acinetobacter sp. A47] Length = 160 Score = 66.2 bits (160), Expect = 4e-11 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + W+++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWEEIGDQPCSVARTLSVLGDRWTMLILRNAFMGVRRFDDF 42 >WP_005293683.1 transcriptional regulator [Acinetobacter sp. NIPH 2100] ENX41228.1 hypothetical protein F887_01624 [Acinetobacter sp. NIPH 2100] Length = 160 Score = 66.2 bits (160), Expect = 4e-11 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + WD++GDQ CSVART+S+LGDRWTML++R +F G FD+F Sbjct: 1 MKWDEIGDQPCSVARTLSVLGDRWTMLILRNSFMGIRRFDDF 42 >WP_005230190.1 MULTISPECIES: transcriptional regulator [Acinetobacter] ENX05494.1 hypothetical protein F898_02438 [Acinetobacter sp. NIPH 1847] ENX37905.1 hypothetical protein F888_02085 [Acinetobacter sp. NIPH 3623] Length = 160 Score = 66.2 bits (160), Expect = 4e-11 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + W+++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWEEIGDQPCSVARTLSVLGDRWTMLILRNAFMGVRRFDDF 42 >WP_004879302.1 MULTISPECIES: transcriptional regulator [Acinetobacter] ENV36996.1 hypothetical protein F959_01804 [Acinetobacter venetianus RAG-1 = CIP 110063] ERS00341.1 HxlR family transcriptional regulator [Acinetobacter sp. COS3] Length = 160 Score = 66.2 bits (160), Expect = 4e-11 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + W+++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWEEIGDQPCSVARTLSVLGDRWTMLILRNAFMGVRRFDDF 42 >WP_004771974.1 MULTISPECIES: transcriptional regulator [Acinetobacter] ENU91349.1 hypothetical protein F971_02441 [Acinetobacter sp. NIPH 758] ENX22327.1 hypothetical protein F892_01569 [Acinetobacter sp. NIPH 2168] KHF77703.1 Transcriptional regulator, HxlR family [Acinetobacter sp. neg1] KYQ82622.1 HxlR family transcriptional regulator [Acinetobacter sp. NRRL B-65365] OEC92024.1 HxlR family transcriptional regulator [Acinetobacter sp. YK3] Length = 160 Score = 66.2 bits (160), Expect = 4e-11 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -3 Query: 131 VNWDQVGDQICSVARTMSILGDRWTMLVVREAFAGTTLFDEF 6 + W+++GDQ CSVART+S+LGDRWTML++R AF G FD+F Sbjct: 1 MKWEEIGDQPCSVARTLSVLGDRWTMLILRNAFMGVRRFDDF 42