BLASTX nr result
ID: Glycyrrhiza28_contig00026960
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00026960 (384 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019440002.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 8e-07 XP_012569452.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 2e-06 XP_004486343.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 4e-06 GAU38977.1 hypothetical protein TSUD_378530 [Trifolium subterran... 52 7e-06 >XP_019440002.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Lupinus angustifolius] OIW13865.1 hypothetical protein TanjilG_31754 [Lupinus angustifolius] Length = 695 Score = 56.6 bits (135), Expect = 8e-07 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = -1 Query: 384 EATKMAGWFLTTKEEAKSWLLSRGSTETVTASDSLV*GVPTAALPH 247 EA + AGWFL TK AKSWL SR STE ++AS S+ GVP AL H Sbjct: 650 EAPEQAGWFLMTKAAAKSWLESRSSTEPISASSSMDLGVPAMALHH 695 >XP_012569452.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Cicer arietinum] Length = 698 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = -1 Query: 384 EATKMAGWFLTTKEEAKSWLLSRGSTETVTASDSLV*GVPTAALPH 247 +AT M GWF TT +EAKSWL SR STET+ A +S VPT AL H Sbjct: 653 KATNMVGWFFTTNQEAKSWLHSRDSTETLAALNSTGLVVPTEALHH 698 >XP_004486343.1 PREDICTED: pentatricopeptide repeat-containing protein At4g16390, chloroplastic-like [Cicer arietinum] Length = 692 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -1 Query: 366 GWFLTTKEEAKSWLLSRGSTETVTASDSLV*GVPTAALPH 247 GWFL TKE AKSWL SRGST+++ DSLV P+ ALP+ Sbjct: 653 GWFLVTKEAAKSWLESRGSTKSIAPLDSLVLNAPSMALPY 692 >GAU38977.1 hypothetical protein TSUD_378530 [Trifolium subterraneum] Length = 155 Score = 52.4 bits (124), Expect = 7e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -1 Query: 369 AGWFLTTKEEAKSWLLSRGSTETVTASDSLV*GVPTAALPH 247 AGWFL +KE AK WL SR ST++V A DSLV VP+ +LP+ Sbjct: 115 AGWFLVSKEAAKQWLESRDSTKSVAALDSLVERVPSMSLPY 155