BLASTX nr result
ID: Glycyrrhiza28_contig00026948
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00026948 (226 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015938329.1 PREDICTED: 1-aminocyclopropane-1-carboxylate oxid... 60 2e-11 XP_016174606.1 PREDICTED: probable flavonol synthase 4 [Arachis ... 60 2e-11 GAU24752.1 hypothetical protein TSUD_355810 [Trifolium subterran... 56 2e-10 XP_003529752.2 PREDICTED: flavonol synthase/flavanone 3-hydroxyl... 59 3e-10 XP_003533043.2 PREDICTED: 1-aminocyclopropane-1-carboxylate oxid... 59 4e-10 KHN05336.1 S-norcoclaurine synthase 1 [Glycine soja] 59 4e-10 XP_004510307.1 PREDICTED: 1-aminocyclopropane-1-carboxylate oxid... 52 4e-09 KYP54149.1 Gibberellin 3-beta-dioxygenase 4 [Cajanus cajan] 56 6e-09 OIV89934.1 hypothetical protein TanjilG_00450 [Lupinus angustifo... 60 9e-09 XP_019430324.1 PREDICTED: 1-aminocyclopropane-1-carboxylate oxid... 60 1e-08 BAT98475.1 hypothetical protein VIGAN_09213400 [Vigna angularis ... 60 1e-08 XP_014515960.1 PREDICTED: 1-aminocyclopropane-1-carboxylate oxid... 60 1e-08 XP_017407479.1 PREDICTED: 1-aminocyclopropane-1-carboxylate oxid... 59 2e-08 XP_007135637.1 hypothetical protein PHAVU_010G145700g [Phaseolus... 59 3e-08 XP_003627031.1 downstream target of agl15-4 protein [Medicago tr... 50 8e-08 KOM54880.1 hypothetical protein LR48_Vigan10g077200 [Vigna angul... 49 6e-06 >XP_015938329.1 PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 1 [Arachis duranensis] Length = 372 Score = 60.5 bits (145), Expect(2) = 2e-11 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGIP 160 FVSLCF +DEA CD V + MAKIGCFQL+NHGIP Sbjct: 64 FVSLCFHRDEAECDAVLDAMAKIGCFQLMNHGIP 97 Score = 35.0 bits (79), Expect(2) = 2e-11 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +1 Query: 1 LVLPDKIFSKQKYHETPPKV 60 LVLPDK F KQK ETPPKV Sbjct: 43 LVLPDKFFPKQKLLETPPKV 62 >XP_016174606.1 PREDICTED: probable flavonol synthase 4 [Arachis ipaensis] Length = 370 Score = 60.5 bits (145), Expect(2) = 2e-11 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGIP 160 FVSLCF +DEA CD V + MAKIGCFQL+NHGIP Sbjct: 64 FVSLCFHRDEAECDAVLDAMAKIGCFQLMNHGIP 97 Score = 35.0 bits (79), Expect(2) = 2e-11 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +1 Query: 1 LVLPDKIFSKQKYHETPPKV 60 LVLPDK F KQK ETPPKV Sbjct: 43 LVLPDKFFPKQKLLETPPKV 62 >GAU24752.1 hypothetical protein TSUD_355810 [Trifolium subterraneum] Length = 365 Score = 55.8 bits (133), Expect(2) = 2e-10 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGIP 160 FVSLCF KDE L DVV +A+ GCFQLLNHGIP Sbjct: 64 FVSLCFHKDEDLIDVVLESIARFGCFQLLNHGIP 97 Score = 37.0 bits (84), Expect(2) = 2e-10 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +1 Query: 1 LVLPDKIFSKQKYHETPPKV 60 LVLPDKIF KQ HETPPK+ Sbjct: 43 LVLPDKIFPKQINHETPPKI 62 >XP_003529752.2 PREDICTED: flavonol synthase/flavanone 3-hydroxylase-like [Glycine max] KRH47216.1 hypothetical protein GLYMA_07G015900 [Glycine max] Length = 364 Score = 58.5 bits (140), Expect(2) = 3e-10 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGIPL 163 FVSLCF D+AL DVVS+ +A++GCFQLLNHGIPL Sbjct: 71 FVSLCFHCDDALRDVVSDSLARLGCFQLLNHGIPL 105 Score = 33.1 bits (74), Expect(2) = 3e-10 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = +1 Query: 1 LVLPDKIFSKQKYHETPPKV 60 LVLPDKIF KQK E PP+V Sbjct: 50 LVLPDKIFPKQKQLEAPPEV 69 >XP_003533043.2 PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Glycine max] KRH44281.1 hypothetical protein GLYMA_08G201400 [Glycine max] Length = 365 Score = 58.9 bits (141), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGIPL 163 FVSLCF D+AL D+VS+ +A+IGCFQLLNHGIPL Sbjct: 71 FVSLCFHCDDALRDIVSDSLARIGCFQLLNHGIPL 105 Score = 32.3 bits (72), Expect(2) = 4e-10 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 1 LVLPDKIFSKQKYHETPPKV 60 LVLPDKIF KQ + E PP+V Sbjct: 50 LVLPDKIFPKQNHLEAPPEV 69 >KHN05336.1 S-norcoclaurine synthase 1 [Glycine soja] Length = 356 Score = 58.9 bits (141), Expect(2) = 4e-10 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGIPL 163 FVSLCF D+AL D+VS+ +A+IGCFQLLNHGIPL Sbjct: 70 FVSLCFHCDDALRDIVSDSLARIGCFQLLNHGIPL 104 Score = 32.3 bits (72), Expect(2) = 4e-10 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +1 Query: 1 LVLPDKIFSKQKYHETPPKV 60 LVLPDKIF KQ + E PP+V Sbjct: 49 LVLPDKIFPKQNHLEAPPEV 68 >XP_004510307.1 PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 3 [Cicer arietinum] Length = 372 Score = 52.0 bits (123), Expect(2) = 4e-09 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGI 157 FVS CF +DE L DVVS+ M + GCFQL+NHGI Sbjct: 74 FVSFCFHEDEDLVDVVSDSMVRFGCFQLINHGI 106 Score = 36.2 bits (82), Expect(2) = 4e-09 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = +1 Query: 1 LVLPDKIFSKQKYHETPPKVRVLVF 75 LVLPDKIF KQ +ETPPK+ + F Sbjct: 53 LVLPDKIFPKQSNNETPPKIDFVSF 77 >KYP54149.1 Gibberellin 3-beta-dioxygenase 4 [Cajanus cajan] Length = 359 Score = 56.2 bits (134), Expect(2) = 6e-09 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGIP 160 FV+LCF +D AL DVVS+ +A IGCFQLLNHGIP Sbjct: 64 FVALCFHRDRALRDVVSDSLAGIGCFQLLNHGIP 97 Score = 31.2 bits (69), Expect(2) = 6e-09 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 1 LVLPDKIFSKQKYHETPPKV 60 LVLPDKIF KQ++ PP+V Sbjct: 43 LVLPDKIFPKQRHLHAPPEV 62 >OIV89934.1 hypothetical protein TanjilG_00450 [Lupinus angustifolius] Length = 328 Score = 59.7 bits (143), Expect = 9e-09 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGIP 160 FVSLCF +DEA+ DVVS+ MA+IGCFQL+NHGIP Sbjct: 67 FVSLCFHEDEAVYDVVSDSMARIGCFQLVNHGIP 100 >XP_019430324.1 PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase [Lupinus angustifolius] Length = 363 Score = 59.7 bits (143), Expect = 1e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGIP 160 FVSLCF +DEA+ DVVS+ MA+IGCFQL+NHGIP Sbjct: 67 FVSLCFHEDEAVYDVVSDSMARIGCFQLVNHGIP 100 >BAT98475.1 hypothetical protein VIGAN_09213400 [Vigna angularis var. angularis] Length = 367 Score = 59.7 bits (143), Expect = 1e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGIP 160 FVSLCF +D+AL DVVS+ +A+IGCFQLLNHGIP Sbjct: 71 FVSLCFHRDDALRDVVSDSLARIGCFQLLNHGIP 104 >XP_014515960.1 PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5 [Vigna radiata var. radiata] Length = 367 Score = 59.7 bits (143), Expect = 1e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGIP 160 FVSLCF +D+AL DVVS+ +A+IGCFQLLNHGIP Sbjct: 71 FVSLCFHRDDALRDVVSDSLARIGCFQLLNHGIP 104 >XP_017407479.1 PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase-like [Vigna angularis] KOM27392.1 hypothetical protein LR48_Vigan406s020200 [Vigna angularis] Length = 367 Score = 58.9 bits (141), Expect = 2e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGIP 160 FVSLCF +D AL DVVS+ +A+IGCFQLLNHGIP Sbjct: 71 FVSLCFHRDNALRDVVSDSLARIGCFQLLNHGIP 104 >XP_007135637.1 hypothetical protein PHAVU_010G145700g [Phaseolus vulgaris] ESW07631.1 hypothetical protein PHAVU_010G145700g [Phaseolus vulgaris] Length = 369 Score = 58.5 bits (140), Expect = 3e-08 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGIP 160 FVSLCF +D+AL DVVS+ +++IGCFQLLNHGIP Sbjct: 71 FVSLCFHRDDALRDVVSDSLSRIGCFQLLNHGIP 104 >XP_003627031.1 downstream target of agl15-4 protein [Medicago truncatula] AET01507.1 downstream target of agl15-4 protein [Medicago truncatula] Length = 369 Score = 49.7 bits (117), Expect(2) = 8e-08 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = +2 Query: 59 FVSLCFQKDEALCDVVSNPMAKIGCFQLLNHGI 157 FV+LCF +DE L DVV +A+ GCFQL+NHGI Sbjct: 64 FVALCFHEDEDLIDVVLESIARFGCFQLINHGI 96 Score = 33.9 bits (76), Expect(2) = 8e-08 Identities = 16/20 (80%), Positives = 16/20 (80%) Frame = +1 Query: 1 LVLPDKIFSKQKYHETPPKV 60 LVLPDKIF KQ ETPPKV Sbjct: 43 LVLPDKIFPKQINDETPPKV 62 >KOM54880.1 hypothetical protein LR48_Vigan10g077200 [Vigna angularis] Length = 94 Score = 49.3 bits (116), Expect = 6e-06 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -2 Query: 168 SSNGIPWLRSWKHPILAMGFETTSQRASSFWK 73 S +GI W SWKHPI+A ETTSQRASS WK Sbjct: 63 SCDGISWFSSWKHPIVARESETTSQRASSRWK 94