BLASTX nr result
ID: Glycyrrhiza28_contig00026881
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00026881 (362 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAT92089.1 hypothetical protein VIGAN_07075000 [Vigna angularis ... 87 4e-20 XP_007157005.1 hypothetical protein PHAVU_002G035700g, partial [... 93 1e-19 XP_019442297.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FK... 87 4e-19 OIW11806.1 hypothetical protein TanjilG_03467 [Lupinus angustifo... 87 4e-19 XP_004511480.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FK... 90 1e-18 ACJ85755.1 unknown [Medicago truncatula] AFK47861.1 unknown [Med... 90 1e-18 XP_003610935.1 FKBP-type peptidyl-prolyl cis-trans isomerase [Me... 90 1e-18 XP_003537959.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FK... 90 1e-18 KHN35105.1 Peptidyl-prolyl cis-trans isomerase FKBP53 [Glycine s... 90 2e-18 GAU12431.1 hypothetical protein TSUD_229650 [Trifolium subterran... 89 4e-18 KYP52662.1 FK506-binding protein [Cajanus cajan] 88 7e-18 KHN34156.1 Peptidyl-prolyl cis-trans isomerase FKBP53 [Glycine s... 87 8e-18 XP_015964602.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FK... 87 1e-17 XP_016202214.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FK... 87 1e-17 XP_017407817.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FK... 87 1e-17 XP_006573842.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FK... 87 1e-17 XP_003517541.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FK... 87 1e-17 XP_019422025.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FK... 87 1e-17 XP_014519376.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FK... 87 1e-17 XP_019424030.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FK... 87 2e-17 >BAT92089.1 hypothetical protein VIGAN_07075000 [Vigna angularis var. angularis] Length = 100 Score = 87.4 bits (215), Expect = 4e-20 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDVN 135 GINGMRIGDKRRITIPPSMGY DKRVG+IP N+WLVFDVELVDV+ Sbjct: 55 GINGMRIGDKRRITIPPSMGYADKRVGTIPPNAWLVFDVELVDVD 99 >XP_007157005.1 hypothetical protein PHAVU_002G035700g, partial [Phaseolus vulgaris] ESW28999.1 hypothetical protein PHAVU_002G035700g, partial [Phaseolus vulgaris] Length = 494 Score = 92.8 bits (229), Expect = 1e-19 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDVN 135 G+NGMRIGDKRRITIPPSMGYGDKRVG+IPQNSWLVFDVELVDV+ Sbjct: 449 GVNGMRIGDKRRITIPPSMGYGDKRVGTIPQNSWLVFDVELVDVD 493 >XP_019442297.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53 [Lupinus angustifolius] Length = 189 Score = 87.4 bits (215), Expect = 4e-19 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDV 132 G+NGMRIGDKRRIT+PPSMGYGDKR GSIP NSWLVFDVELV+V Sbjct: 144 GVNGMRIGDKRRITVPPSMGYGDKRAGSIPPNSWLVFDVELVNV 187 >OIW11806.1 hypothetical protein TanjilG_03467 [Lupinus angustifolius] Length = 193 Score = 87.4 bits (215), Expect = 4e-19 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDV 132 G+NGMRIGDKRRIT+PPSMGYGDKR GSIP NSWLVFDVELV+V Sbjct: 148 GVNGMRIGDKRRITVPPSMGYGDKRAGSIPPNSWLVFDVELVNV 191 >XP_004511480.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53 [Cicer arietinum] Length = 499 Score = 90.1 bits (222), Expect = 1e-18 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDV 132 G+NGMRIGDKRRIT+PPSMGYGDKRVGSIPQNSWLVFDVEL+ V Sbjct: 454 GVNGMRIGDKRRITVPPSMGYGDKRVGSIPQNSWLVFDVELIGV 497 >ACJ85755.1 unknown [Medicago truncatula] AFK47861.1 unknown [Medicago truncatula] Length = 502 Score = 89.7 bits (221), Expect = 1e-18 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDV 132 G+NGMR+GDKRR+TIPPSMGYGDKRVGSIPQNSWLVFDVELV V Sbjct: 456 GVNGMRVGDKRRLTIPPSMGYGDKRVGSIPQNSWLVFDVELVGV 499 >XP_003610935.1 FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula] AES93893.1 FKBP-type peptidyl-prolyl cis-trans isomerase [Medicago truncatula] Length = 502 Score = 89.7 bits (221), Expect = 1e-18 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDV 132 G+NGMR+GDKRR+TIPPSMGYGDKRVGSIPQNSWLVFDVELV V Sbjct: 456 GVNGMRVGDKRRLTIPPSMGYGDKRVGSIPQNSWLVFDVELVGV 499 >XP_003537959.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53-like [Glycine max] KRH27794.1 hypothetical protein GLYMA_11G014400 [Glycine max] Length = 503 Score = 89.7 bits (221), Expect = 1e-18 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDVN 135 GINGMRIGDKRRITIPPSMGY DKRVGSIP NSWLVFDVELVDV+ Sbjct: 458 GINGMRIGDKRRITIPPSMGYADKRVGSIPPNSWLVFDVELVDVD 502 >KHN35105.1 Peptidyl-prolyl cis-trans isomerase FKBP53 [Glycine soja] Length = 734 Score = 89.7 bits (221), Expect = 2e-18 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDVN 135 GINGMRIGDKRRITIPPSMGY DKRVGSIP NSWLVFDVELVDV+ Sbjct: 689 GINGMRIGDKRRITIPPSMGYADKRVGSIPPNSWLVFDVELVDVD 733 >GAU12431.1 hypothetical protein TSUD_229650 [Trifolium subterraneum] Length = 511 Score = 88.6 bits (218), Expect = 4e-18 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDV 132 GINGMR+GDKRR+TIPPSMGYGDKR+G+IPQNSWLVFDVELV V Sbjct: 466 GINGMRVGDKRRLTIPPSMGYGDKRIGAIPQNSWLVFDVELVGV 509 >KYP52662.1 FK506-binding protein [Cajanus cajan] Length = 487 Score = 87.8 bits (216), Expect = 7e-18 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDVN 135 GINGMRIGDKRRITIPPSMGY DKRVGSIP NSWLVFDVELV+V+ Sbjct: 442 GINGMRIGDKRRITIPPSMGYADKRVGSIPPNSWLVFDVELVNVD 486 >KHN34156.1 Peptidyl-prolyl cis-trans isomerase FKBP53 [Glycine soja] Length = 434 Score = 87.4 bits (215), Expect = 8e-18 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDV 132 GINGMRIGDKRRITIPPSMGY DKRVGSIP +SWLVFDVELVDV Sbjct: 389 GINGMRIGDKRRITIPPSMGYADKRVGSIPPSSWLVFDVELVDV 432 >XP_015964602.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53 [Arachis duranensis] Length = 493 Score = 87.4 bits (215), Expect = 1e-17 Identities = 37/45 (82%), Positives = 44/45 (97%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDVN 135 G+NGMR+GDKRRIT+PPSMGYGD+RVGSIP NSWLVFDVEL++V+ Sbjct: 448 GVNGMRVGDKRRITVPPSMGYGDRRVGSIPPNSWLVFDVELINVD 492 >XP_016202214.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53 [Arachis ipaensis] Length = 494 Score = 87.4 bits (215), Expect = 1e-17 Identities = 37/45 (82%), Positives = 44/45 (97%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDVN 135 G+NGMR+GDKRRIT+PPSMGYGD+RVGSIP NSWLVFDVEL++V+ Sbjct: 449 GVNGMRVGDKRRITVPPSMGYGDRRVGSIPPNSWLVFDVELINVD 493 >XP_017407817.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53 [Vigna angularis] BAU00683.1 hypothetical protein VIGAN_10229700 [Vigna angularis var. angularis] Length = 497 Score = 87.4 bits (215), Expect = 1e-17 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDVN 135 GINGMRIGDKRRITIPPSMGY DKRVG+IP N+WLVFDVELVDV+ Sbjct: 452 GINGMRIGDKRRITIPPSMGYADKRVGTIPPNAWLVFDVELVDVD 496 >XP_006573842.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53-like isoform X2 [Glycine max] Length = 500 Score = 87.4 bits (215), Expect = 1e-17 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDV 132 GINGMRIGDKRRITIPPSMGY DKRVGSIP +SWLVFDVELVDV Sbjct: 455 GINGMRIGDKRRITIPPSMGYADKRVGSIPPSSWLVFDVELVDV 498 >XP_003517541.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53-like isoform X1 [Glycine max] KRH77741.1 hypothetical protein GLYMA_01G231400 [Glycine max] Length = 503 Score = 87.4 bits (215), Expect = 1e-17 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDV 132 GINGMRIGDKRRITIPPSMGY DKRVGSIP +SWLVFDVELVDV Sbjct: 458 GINGMRIGDKRRITIPPSMGYADKRVGSIPPSSWLVFDVELVDV 501 >XP_019422025.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53-like [Lupinus angustifolius] OIV94947.1 hypothetical protein TanjilG_22144 [Lupinus angustifolius] Length = 506 Score = 87.4 bits (215), Expect = 1e-17 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDV 132 G+NGMRIGDKRRIT+PPSMGYGDKR GSIP NSWLVFDVELV+V Sbjct: 461 GVNGMRIGDKRRITVPPSMGYGDKRAGSIPPNSWLVFDVELVNV 504 >XP_014519376.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53 [Vigna radiata var. radiata] Length = 506 Score = 87.4 bits (215), Expect = 1e-17 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDVN 135 GINGMRIGDKRRITIPPSMGY DKRVG+IP N+WLVFDVELVDV+ Sbjct: 461 GINGMRIGDKRRITIPPSMGYADKRVGTIPPNAWLVFDVELVDVD 505 >XP_019424030.1 PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP53 [Lupinus angustifolius] Length = 513 Score = 86.7 bits (213), Expect = 2e-17 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = +1 Query: 1 GINGMRIGDKRRITIPPSMGYGDKRVGSIPQNSWLVFDVELVDVN 135 G+NGMRIGDKRRIT+PPSMGYGDKR G+IP NSWLVFDVELV+V+ Sbjct: 468 GVNGMRIGDKRRITVPPSMGYGDKRAGTIPPNSWLVFDVELVNVD 512