BLASTX nr result
ID: Glycyrrhiza28_contig00026608
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00026608 (258 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU24130.1 hypothetical protein TSUD_83650 [Trifolium subterraneum] 56 5e-08 >GAU24130.1 hypothetical protein TSUD_83650 [Trifolium subterraneum] Length = 131 Score = 55.8 bits (133), Expect = 5e-08 Identities = 36/73 (49%), Positives = 43/73 (58%), Gaps = 11/73 (15%) Frame = -2 Query: 257 LVGKGGTFP*GNVGIVGKGGS---FGRVG--------VVCRRWRAARPISMLEKHIAMKV 111 +VG GG FP GNVGI GKGG+ FG+VG VVC+RWRA+R + MLE Sbjct: 51 VVGNGGRFPCGNVGIEGKGGNVVGFGKVGILGKFGCVVVCKRWRASRLMLMLEMVTTKSR 110 Query: 110 ANMKQLL*EAMTS 72 MK L EA+ S Sbjct: 111 VVMKDLF-EAIDS 122