BLASTX nr result
ID: Glycyrrhiza28_contig00026556
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00026556 (349 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003598903.2 PPR containing plant-like protein [Medicago trunc... 81 1e-15 XP_004511291.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 3e-15 XP_004515007.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 1e-14 XP_012569772.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 4e-14 XP_015881935.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 2e-13 XP_014498722.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 3e-13 BAT93460.1 hypothetical protein VIGAN_07242700 [Vigna angularis ... 74 3e-13 XP_017425383.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 3e-13 XP_007149018.1 hypothetical protein PHAVU_005G033500g [Phaseolus... 73 1e-12 KYP41047.1 Pentatricopeptide repeat-containing protein At4g20740... 72 2e-12 KDO83244.1 hypothetical protein CISIN_1g006744mg [Citrus sinensis] 70 8e-12 XP_019432613.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 8e-12 XP_010645700.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 8e-12 XP_010670382.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 8e-12 GAU10008.1 hypothetical protein TSUD_120070 [Trifolium subterran... 70 1e-11 XP_006482966.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 3e-11 XP_006438906.1 hypothetical protein CICLE_v10030824mg [Citrus cl... 69 3e-11 KMT17191.1 hypothetical protein BVRB_2g040990 [Beta vulgaris sub... 69 4e-11 XP_018810533.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 5e-11 XP_014632180.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 9e-11 >XP_003598903.2 PPR containing plant-like protein [Medicago truncatula] AES69154.2 PPR containing plant-like protein [Medicago truncatula] Length = 723 Score = 81.3 bits (199), Expect = 1e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 110 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQTPT PNKFYFFYGHRKPSQNRPTVRGGLFSNR Sbjct: 1 MPPQTPTPPNKFYFFYGHRKPSQNRPTVRGGLFSNR 36 >XP_004511291.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_004511445.2 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012574365.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012574366.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012574367.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012574368.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] Length = 720 Score = 80.1 bits (196), Expect = 3e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 110 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQTPT PNKFYF+YGHRKPSQNRPTVRGGLFSNR Sbjct: 1 MPPQTPTTPNKFYFYYGHRKPSQNRPTVRGGLFSNR 36 >XP_004515007.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] Length = 720 Score = 78.6 bits (192), Expect = 1e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 110 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQTPT PNKFYF+YGHR+PSQNRPTVRGGLFSNR Sbjct: 1 MPPQTPTTPNKFYFYYGHRQPSQNRPTVRGGLFSNR 36 >XP_012569772.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012569773.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012569774.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012569775.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] XP_012569776.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Cicer arietinum] Length = 720 Score = 77.0 bits (188), Expect = 4e-14 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 110 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 M PQTPT PNKFYF+YGHRKPSQNRPTVRGGLFSNR Sbjct: 1 MSPQTPTTPNKFYFYYGHRKPSQNRPTVRGGLFSNR 36 >XP_015881935.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 isoform X1 [Ziziphus jujuba] XP_015881937.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 isoform X2 [Ziziphus jujuba] Length = 714 Score = 75.1 bits (183), Expect = 2e-13 Identities = 34/37 (91%), Positives = 35/37 (94%), Gaps = 1/37 (2%) Frame = -3 Query: 110 MPPQTP-TKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQ+P TKP KFYFFYGHRKPSQNRPTVRGGLFSNR Sbjct: 1 MPPQSPPTKPQKFYFFYGHRKPSQNRPTVRGGLFSNR 37 >XP_014498722.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Vigna radiata var. radiata] Length = 716 Score = 74.7 bits (182), Expect = 3e-13 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 2/38 (5%) Frame = -3 Query: 110 MPPQTP--TKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQ P KPNKFYFFYGHRKPSQNRPTVRGGLFSNR Sbjct: 1 MPPQVPQPNKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 38 >BAT93460.1 hypothetical protein VIGAN_07242700 [Vigna angularis var. angularis] Length = 716 Score = 74.3 bits (181), Expect = 3e-13 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 2/38 (5%) Frame = -3 Query: 110 MPPQTPT--KPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQ P KPNKFYFFYGHRKPSQNRPTVRGGLFSNR Sbjct: 1 MPPQVPQPIKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 38 >XP_017425383.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Vigna angularis] KOM42525.1 hypothetical protein LR48_Vigan05g012900 [Vigna angularis] Length = 716 Score = 74.3 bits (181), Expect = 3e-13 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 2/38 (5%) Frame = -3 Query: 110 MPPQTPT--KPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQ P KPNKFYFFYGHRKPSQNRPTVRGGLFSNR Sbjct: 1 MPPQVPQPIKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 38 >XP_007149018.1 hypothetical protein PHAVU_005G033500g [Phaseolus vulgaris] ESW21012.1 hypothetical protein PHAVU_005G033500g [Phaseolus vulgaris] Length = 715 Score = 72.8 bits (177), Expect = 1e-12 Identities = 33/38 (86%), Positives = 33/38 (86%), Gaps = 2/38 (5%) Frame = -3 Query: 110 MPPQTP--TKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQ P KPN FYFFYGHRKPSQNRPTVRGGLFSNR Sbjct: 1 MPPQVPQPNKPNNFYFFYGHRKPSQNRPTVRGGLFSNR 38 >KYP41047.1 Pentatricopeptide repeat-containing protein At4g20740 family [Cajanus cajan] Length = 679 Score = 72.4 bits (176), Expect = 2e-12 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = -3 Query: 110 MPPQTPT-KPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQ P PNKFYFFYGHRKPSQNRPTVRGGLFSNR Sbjct: 1 MPPQPPQPNPNKFYFFYGHRKPSQNRPTVRGGLFSNR 37 >KDO83244.1 hypothetical protein CISIN_1g006744mg [Citrus sinensis] Length = 632 Score = 70.5 bits (171), Expect = 8e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -3 Query: 110 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQTP +P K YFFYGHRKPSQNRPTV GGLFSNR Sbjct: 1 MPPQTPQRPPKPYFFYGHRKPSQNRPTVYGGLFSNR 36 >XP_019432613.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Lupinus angustifolius] OIW21254.1 hypothetical protein TanjilG_31184 [Lupinus angustifolius] Length = 725 Score = 70.5 bits (171), Expect = 8e-12 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 2/37 (5%) Frame = -3 Query: 107 PPQ--TPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 PPQ TPTK NK+YFFYGHR PSQNRPTVRGGLFSNR Sbjct: 3 PPQAPTPTKANKYYFFYGHRNPSQNRPTVRGGLFSNR 39 >XP_010645700.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Vitis vinifera] XP_019073365.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Vitis vinifera] XP_019073366.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Vitis vinifera] CBI17752.3 unnamed protein product, partial [Vitis vinifera] Length = 729 Score = 70.5 bits (171), Expect = 8e-12 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = -3 Query: 110 MPPQT-PTKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQ P KP+KFYFFYGHRKPSQNRPTV GGLFSNR Sbjct: 1 MPPQPQPPKPHKFYFFYGHRKPSQNRPTVHGGLFSNR 37 >XP_010670382.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Beta vulgaris subsp. vulgaris] Length = 741 Score = 70.5 bits (171), Expect = 8e-12 Identities = 33/39 (84%), Positives = 33/39 (84%), Gaps = 2/39 (5%) Frame = -3 Query: 113 KMPPQTP--TKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 KMPPQ P KPNKFYFFYG RKPSQNRPTV GGLFSNR Sbjct: 2 KMPPQPPPPAKPNKFYFFYGKRKPSQNRPTVSGGLFSNR 40 >GAU10008.1 hypothetical protein TSUD_120070 [Trifolium subterraneum] Length = 626 Score = 70.1 bits (170), Expect = 1e-11 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -3 Query: 110 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPP P PNKFYFFYGHRKPSQNRPTVRGGLFSNR Sbjct: 1 MPP--PQTPNKFYFFYGHRKPSQNRPTVRGGLFSNR 34 >XP_006482966.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Citrus sinensis] Length = 721 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 110 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQTP +P K YFFYGHRKPSQNRPTV GG FSNR Sbjct: 1 MPPQTPQRPPKPYFFYGHRKPSQNRPTVYGGFFSNR 36 >XP_006438906.1 hypothetical protein CICLE_v10030824mg [Citrus clementina] ESR52146.1 hypothetical protein CICLE_v10030824mg [Citrus clementina] Length = 721 Score = 68.9 bits (167), Expect = 3e-11 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 110 MPPQTPTKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQTP +P K YFFYGHRKPSQNRPTV GG FSNR Sbjct: 1 MPPQTPQRPPKPYFFYGHRKPSQNRPTVYGGFFSNR 36 >KMT17191.1 hypothetical protein BVRB_2g040990 [Beta vulgaris subsp. vulgaris] Length = 739 Score = 68.6 bits (166), Expect = 4e-11 Identities = 32/38 (84%), Positives = 32/38 (84%), Gaps = 2/38 (5%) Frame = -3 Query: 110 MPPQTP--TKPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQ P KPNKFYFFYG RKPSQNRPTV GGLFSNR Sbjct: 1 MPPQPPPPAKPNKFYFFYGKRKPSQNRPTVSGGLFSNR 38 >XP_018810533.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Juglans regia] XP_018810534.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Juglans regia] XP_018810535.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740 [Juglans regia] Length = 726 Score = 68.2 bits (165), Expect = 5e-11 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 1/37 (2%) Frame = -3 Query: 110 MPPQTPT-KPNKFYFFYGHRKPSQNRPTVRGGLFSNR 3 MPPQ+P KP+ +YFFYGHRKPSQNRP VRGGLFSNR Sbjct: 1 MPPQSPPPKPHNYYFFYGHRKPSQNRPVVRGGLFSNR 37 >XP_014632180.1 PREDICTED: pentatricopeptide repeat-containing protein At4g20740-like [Glycine max] KRH55198.1 hypothetical protein GLYMA_06G236700 [Glycine max] Length = 764 Score = 67.4 bits (163), Expect = 9e-11 Identities = 35/52 (67%), Positives = 35/52 (67%), Gaps = 15/52 (28%) Frame = -3 Query: 113 KMPPQTP--TKP-------------NKFYFFYGHRKPSQNRPTVRGGLFSNR 3 KMPPQ P TKP NKFYFFYGHR PSQNRPTVRGGLFSNR Sbjct: 31 KMPPQVPKPTKPRNCGPPFTIPKPTNKFYFFYGHRNPSQNRPTVRGGLFSNR 82