BLASTX nr result
ID: Glycyrrhiza28_contig00026528
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00026528 (327 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012571657.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 5e-13 KYP44227.1 hypothetical protein KK1_034292 [Cajanus cajan] 70 8e-12 XP_003603286.1 proton gradient regulation protein [Medicago trun... 70 9e-12 GAU27050.1 hypothetical protein TSUD_314120 [Trifolium subterran... 69 2e-11 KHN29635.1 Pentatricopeptide repeat-containing protein, chloropl... 69 3e-11 KHN07014.1 Pentatricopeptide repeat-containing protein, chloropl... 68 4e-11 XP_003527773.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 4e-11 KOM42073.1 hypothetical protein LR48_Vigan04g227100 [Vigna angul... 67 1e-10 XP_017422433.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 1e-10 XP_014501104.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 1e-10 XP_016180816.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 3e-10 XP_016196941.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 3e-10 XP_015945453.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 3e-10 XP_015958364.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 3e-10 XP_016180814.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 3e-10 XP_016196940.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 3e-10 XP_015945451.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 3e-10 XP_015958361.1 PREDICTED: pentatricopeptide repeat-containing pr... 66 3e-10 XP_007136936.1 hypothetical protein PHAVU_009G086500g [Phaseolus... 65 7e-10 OIW14970.1 hypothetical protein TanjilG_30689 [Lupinus angustifo... 57 3e-07 >XP_012571657.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Cicer arietinum] XP_012571658.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Cicer arietinum] XP_012571659.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Cicer arietinum] Length = 1120 Score = 73.6 bits (179), Expect = 5e-13 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GH LSGNKDQAFSVFKKMMVVG PNAETFAQLPNKC Sbjct: 1084 GHGLSGNKDQAFSVFKKMMVVGCSPNAETFAQLPNKC 1120 >KYP44227.1 hypothetical protein KK1_034292 [Cajanus cajan] Length = 718 Score = 70.1 bits (170), Expect = 8e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GHS+SGNKD+AFSVFKKMMVVG PNA TFAQLPNKC Sbjct: 682 GHSMSGNKDRAFSVFKKMMVVGCSPNAGTFAQLPNKC 718 >XP_003603286.1 proton gradient regulation protein [Medicago truncatula] AES73537.1 proton gradient regulation protein [Medicago truncatula] Length = 1246 Score = 70.1 bits (170), Expect = 9e-12 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNK 45 GHSLSGNKDQAFSVFKKMMVVG PN ETFAQLPNK Sbjct: 1085 GHSLSGNKDQAFSVFKKMMVVGCSPNTETFAQLPNK 1120 >GAU27050.1 hypothetical protein TSUD_314120 [Trifolium subterraneum] Length = 955 Score = 69.3 bits (168), Expect = 2e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GHSLSGN+DQAFSVF+KMMVVG PN ET+AQLPNKC Sbjct: 919 GHSLSGNRDQAFSVFEKMMVVGCSPNRETYAQLPNKC 955 >KHN29635.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 691 Score = 68.6 bits (166), Expect = 3e-11 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GHS SGNKD+AFSVFKKMMVVG PNA TFAQLPNKC Sbjct: 655 GHSKSGNKDRAFSVFKKMMVVGCSPNAGTFAQLPNKC 691 >KHN07014.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 1113 Score = 68.2 bits (165), Expect = 4e-11 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GHS SGNKD+AFSVFKKMM+VG PNA TFAQLPNKC Sbjct: 1077 GHSKSGNKDRAFSVFKKMMIVGCSPNAGTFAQLPNKC 1113 >XP_003527773.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Glycine max] KRH52317.1 hypothetical protein GLYMA_06G061000 [Glycine max] Length = 1113 Score = 68.2 bits (165), Expect = 4e-11 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GHS SGNKD+AFSVFKKMM+VG PNA TFAQLPNKC Sbjct: 1077 GHSKSGNKDRAFSVFKKMMIVGCSPNAGTFAQLPNKC 1113 >KOM42073.1 hypothetical protein LR48_Vigan04g227100 [Vigna angularis] Length = 1102 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GH++SGNKD+AFSV KKMMVVG PNA TFAQLPNKC Sbjct: 1066 GHTMSGNKDRAFSVLKKMMVVGCSPNAGTFAQLPNKC 1102 >XP_017422433.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Vigna angularis] BAT78072.1 hypothetical protein VIGAN_02070900 [Vigna angularis var. angularis] Length = 1106 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GH++SGNKD+AFSV KKMMVVG PNA TFAQLPNKC Sbjct: 1070 GHTMSGNKDRAFSVLKKMMVVGCSPNAGTFAQLPNKC 1106 >XP_014501104.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic [Vigna radiata var. radiata] Length = 1106 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GH++SGNKD+AFSV KKMMVVG PNA TFAQLPNKC Sbjct: 1070 GHTMSGNKDRAFSVLKKMMVVGCSPNAGTFAQLPNKC 1106 >XP_016180816.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis ipaensis] XP_016180817.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis ipaensis] XP_016180818.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis ipaensis] Length = 1097 Score = 65.9 bits (159), Expect = 3e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GHSLSGNKD+AF+V+KKMMV G PN +TFAQLPNKC Sbjct: 1061 GHSLSGNKDRAFNVYKKMMVQGCSPNRQTFAQLPNKC 1097 >XP_016196941.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis ipaensis] XP_016196942.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis ipaensis] XP_016196943.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis ipaensis] XP_016196944.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis ipaensis] XP_016196945.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis ipaensis] Length = 1098 Score = 65.9 bits (159), Expect = 3e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GHSLSGNKD+AF+V+KKMMV G PN +TFAQLPNKC Sbjct: 1062 GHSLSGNKDRAFNVYKKMMVQGCSPNRQTFAQLPNKC 1098 >XP_015945453.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis duranensis] XP_015945455.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis duranensis] Length = 1098 Score = 65.9 bits (159), Expect = 3e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GHSLSGNKD+AF+V+KKMMV G PN +TFAQLPNKC Sbjct: 1062 GHSLSGNKDRAFNVYKKMMVQGCSPNRQTFAQLPNKC 1098 >XP_015958364.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis duranensis] XP_015958365.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis duranensis] XP_015958366.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis duranensis] XP_015958367.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X2 [Arachis duranensis] Length = 1098 Score = 65.9 bits (159), Expect = 3e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GHSLSGNKD+AF+V+KKMMV G PN +TFAQLPNKC Sbjct: 1062 GHSLSGNKDRAFNVYKKMMVQGCSPNRQTFAQLPNKC 1098 >XP_016180814.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X1 [Arachis ipaensis] XP_016180815.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X1 [Arachis ipaensis] Length = 1112 Score = 65.9 bits (159), Expect = 3e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GHSLSGNKD+AF+V+KKMMV G PN +TFAQLPNKC Sbjct: 1076 GHSLSGNKDRAFNVYKKMMVQGCSPNRQTFAQLPNKC 1112 >XP_016196940.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X1 [Arachis ipaensis] Length = 1113 Score = 65.9 bits (159), Expect = 3e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GHSLSGNKD+AF+V+KKMMV G PN +TFAQLPNKC Sbjct: 1077 GHSLSGNKDRAFNVYKKMMVQGCSPNRQTFAQLPNKC 1113 >XP_015945451.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X1 [Arachis duranensis] XP_015945452.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X1 [Arachis duranensis] Length = 1113 Score = 65.9 bits (159), Expect = 3e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GHSLSGNKD+AF+V+KKMMV G PN +TFAQLPNKC Sbjct: 1077 GHSLSGNKDRAFNVYKKMMVQGCSPNRQTFAQLPNKC 1113 >XP_015958361.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X1 [Arachis duranensis] XP_015958362.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X1 [Arachis duranensis] XP_015958363.1 PREDICTED: pentatricopeptide repeat-containing protein At4g31850, chloroplastic-like isoform X1 [Arachis duranensis] Length = 1113 Score = 65.9 bits (159), Expect = 3e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GHSLSGNKD+AF+V+KKMMV G PN +TFAQLPNKC Sbjct: 1077 GHSLSGNKDRAFNVYKKMMVQGCSPNRQTFAQLPNKC 1113 >XP_007136936.1 hypothetical protein PHAVU_009G086500g [Phaseolus vulgaris] ESW08930.1 hypothetical protein PHAVU_009G086500g [Phaseolus vulgaris] Length = 1106 Score = 64.7 bits (156), Expect = 7e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNKC 42 GH++SGNKD+AFSV KKMMVVG PNA TFAQLP+KC Sbjct: 1070 GHTMSGNKDRAFSVLKKMMVVGCSPNAGTFAQLPDKC 1106 >OIW14970.1 hypothetical protein TanjilG_30689 [Lupinus angustifolius] Length = 1062 Score = 57.0 bits (136), Expect = 3e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -2 Query: 152 GHSLSGNKDQAFSVFKKMMVVGLHPNAETFAQLPNK 45 GHS+SGNKD+AF+V++KMM +G PN T+AQLPNK Sbjct: 1027 GHSMSGNKDRAFTVYEKMMTMGCSPNKGTYAQLPNK 1062