BLASTX nr result
ID: Glycyrrhiza28_contig00026365
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00026365 (405 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004486639.1 PREDICTED: probable sodium-coupled neutral amino ... 58 3e-07 XP_003597936.2 transmembrane amino acid transporter family prote... 54 6e-06 >XP_004486639.1 PREDICTED: probable sodium-coupled neutral amino acid transporter 6 [Cicer arietinum] Length = 488 Score = 58.2 bits (139), Expect = 3e-07 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 1/36 (2%) Frame = +3 Query: 300 MSHRKEGNYTSIPVSS-YLELQPQTESPNSLQRLSF 404 MSHR + NYTSIPVSS Y+ELQPQ +SPNS QRLSF Sbjct: 1 MSHRNDANYTSIPVSSSYIELQPQNDSPNSFQRLSF 36 >XP_003597936.2 transmembrane amino acid transporter family protein [Medicago truncatula] AES68187.2 transmembrane amino acid transporter family protein [Medicago truncatula] Length = 487 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/37 (72%), Positives = 30/37 (81%), Gaps = 2/37 (5%) Frame = +3 Query: 300 MSHRKEGNYTSIPVSS--YLELQPQTESPNSLQRLSF 404 MSH+ + NYTSIPVSS YLELQPQ +S NS QRLSF Sbjct: 1 MSHKNDSNYTSIPVSSSSYLELQPQNDSSNSFQRLSF 37