BLASTX nr result
ID: Glycyrrhiza28_contig00026250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00026250 (267 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP52159.1 Putative BPI/LBP family protein At3g20270 family [Caj... 56 4e-07 XP_013459904.1 LBP/BPI/CETP family, amino-terminal domain protei... 53 8e-07 >KYP52159.1 Putative BPI/LBP family protein At3g20270 family [Cajanus cajan] Length = 492 Score = 55.8 bits (133), Expect = 4e-07 Identities = 29/38 (76%), Positives = 31/38 (81%), Gaps = 4/38 (10%) Frame = +1 Query: 166 MAPFIFF----LLLIPTSGYVQPHEDGFISGVISDKGL 267 MAP I F LLL+PTSGYVQP E+GFISGVISDKGL Sbjct: 1 MAPSIIFSLLSLLLVPTSGYVQPPEEGFISGVISDKGL 38 >XP_013459904.1 LBP/BPI/CETP family, amino-terminal domain protein [Medicago truncatula] KEH33935.1 LBP/BPI/CETP family, amino-terminal domain protein [Medicago truncatula] Length = 137 Score = 53.1 bits (126), Expect = 8e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 175 FIFFLLLIPTSGYVQPHEDGFISGVISDKGL 267 F+ L+LIPTSGYVQP +DGFISGVIS+KGL Sbjct: 8 FLLHLILIPTSGYVQPFKDGFISGVISNKGL 38