BLASTX nr result
ID: Glycyrrhiza28_contig00026079
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00026079 (425 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008778590.1 PREDICTED: uncharacterized protein LOC103698369 [... 85 6e-18 OMO80899.1 reverse transcriptase [Corchorus capsularis] 88 2e-17 OMO58913.1 reverse transcriptase [Corchorus capsularis] 85 2e-16 OMO55593.1 reverse transcriptase [Corchorus capsularis] 85 2e-16 XP_017696450.1 PREDICTED: uncharacterized protein LOC108510821, ... 81 3e-16 XP_008780072.1 PREDICTED: uncharacterized protein LOC103699849, ... 81 3e-16 KZV26699.1 hypothetical protein F511_25442 [Dorcoceras hygrometr... 80 6e-16 XP_008780602.1 PREDICTED: uncharacterized protein LOC103700436, ... 77 1e-15 GAV85487.1 Chromo domain-containing protein [Cephalotus follicul... 77 3e-15 GAV59055.1 Chromo domain-containing protein [Cephalotus follicul... 77 3e-15 XP_017698858.1 PREDICTED: uncharacterized protein LOC108511389, ... 80 6e-15 XP_017700366.1 PREDICTED: uncharacterized protein LOC108511597 [... 80 8e-15 GAV80957.1 Chromo domain-containing protein [Cephalotus follicul... 75 1e-14 OMO91869.1 reverse transcriptase [Corchorus capsularis] 79 2e-14 XP_010910566.1 PREDICTED: uncharacterized protein LOC105036500, ... 74 3e-14 GAV63589.1 Chromo domain-containing protein [Cephalotus follicul... 74 3e-14 GAV77202.1 Chromo domain-containing protein [Cephalotus follicul... 74 3e-14 GAV82008.1 Chromo domain-containing protein [Cephalotus follicul... 73 6e-14 XP_020084494.1 uncharacterized protein LOC109707557 [Ananas como... 74 7e-14 EKG08895.1 Chromo domain-like protein [Macrophomina phaseolina MS6] 74 7e-14 >XP_008778590.1 PREDICTED: uncharacterized protein LOC103698369 [Phoenix dactylifera] Length = 186 Score = 85.1 bits (209), Expect = 6e-18 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 +IVDRKDQVLR RTIPYVKVQW NHSEREATWELEE+MRE+ P LF Sbjct: 139 RIVDRKDQVLRRRTIPYVKVQWNNHSEREATWELEEEMREKFPTLF 184 >OMO80899.1 reverse transcriptase [Corchorus capsularis] Length = 1087 Score = 87.8 bits (216), Expect = 2e-17 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDTPG 150 KIVDRK+QVLR RTIPYVKVQW NHSEREATWELE K++E++P LF+T G Sbjct: 1037 KIVDRKEQVLRRRTIPYVKVQWHNHSEREATWELESKIKEKYPELFETNG 1086 >OMO58913.1 reverse transcriptase [Corchorus capsularis] Length = 1477 Score = 85.1 bits (209), Expect = 2e-16 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDTPG 150 KIVDRK+QVLR RTIPYVK+QW NHSEREATWELE +++E++P LF+T G Sbjct: 1427 KIVDRKEQVLRRRTIPYVKMQWHNHSEREATWELESEIKEKYPELFETNG 1476 >OMO55593.1 reverse transcriptase [Corchorus capsularis] Length = 1385 Score = 84.7 bits (208), Expect = 2e-16 Identities = 37/48 (77%), Positives = 44/48 (91%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDT 156 KIVDRK+QVLR RTIPYVKVQW NHSEREATWELE +++E++P LF+T Sbjct: 1335 KIVDRKEQVLRRRTIPYVKVQWHNHSEREATWELESEIKEKYPELFET 1382 >XP_017696450.1 PREDICTED: uncharacterized protein LOC108510821, partial [Phoenix dactylifera] Length = 208 Score = 81.3 bits (199), Expect = 3e-16 Identities = 35/48 (72%), Positives = 44/48 (91%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDT 156 +IVDRKDQVLR R IPYVKVQW +HSEREATWELE++M++++P LF+T Sbjct: 160 QIVDRKDQVLRHRVIPYVKVQWSHHSEREATWELEDEMKQKYPQLFET 207 >XP_008780072.1 PREDICTED: uncharacterized protein LOC103699849, partial [Phoenix dactylifera] Length = 200 Score = 80.9 bits (198), Expect = 3e-16 Identities = 34/47 (72%), Positives = 43/47 (91%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFD 159 +I+DRK+Q+LR RTIPYVKVQW NH+EREATWELEE+MR+ +P LF+ Sbjct: 152 RIIDRKEQILRRRTIPYVKVQWTNHTEREATWELEEEMRQCYPQLFE 198 >KZV26699.1 hypothetical protein F511_25442 [Dorcoceras hygrometricum] Length = 181 Score = 79.7 bits (195), Expect = 6e-16 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFD 159 +IVD KDQVLR R IPYVKVQW NH EREATWELEEKM E +P+LF+ Sbjct: 117 RIVDTKDQVLRRRIIPYVKVQWSNHIEREATWELEEKMPEHYPYLFE 163 >XP_008780602.1 PREDICTED: uncharacterized protein LOC103700436, partial [Phoenix dactylifera] Length = 126 Score = 77.4 bits (189), Expect = 1e-15 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 +I+DRK+QVLR TIPYVKVQW NHSEREATW+LE+ MR HP LF Sbjct: 78 RIIDRKEQVLRWCTIPYVKVQWSNHSEREATWKLEDDMRARHPQLF 123 >GAV85487.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 127 Score = 76.6 bits (187), Expect = 3e-15 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDT 156 +I+D K+Q+LRT+TIP VKV WRNH EATWELEE +R+EHPHLF T Sbjct: 78 EILDYKEQILRTKTIPLVKVLWRNHGVEEATWELEETIRKEHPHLFKT 125 >GAV59055.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 130 Score = 76.6 bits (187), Expect = 3e-15 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDTPGKSF 141 +I+D K+QVLR++TIP VKV WRNH +EATWELEE MR+E+PHLF T F Sbjct: 78 EILDYKEQVLRSKTIPLVKVLWRNHKVKEATWELEEMMRQEYPHLFKTTCNKF 130 >XP_017698858.1 PREDICTED: uncharacterized protein LOC108511389, partial [Phoenix dactylifera] Length = 1231 Score = 80.5 bits (197), Expect = 6e-15 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFD 159 +I+DRK+QVLR RTIPYVKVQW NHSEREATWELE++M HP F+ Sbjct: 1183 RIIDRKEQVLRRRTIPYVKVQWSNHSEREATWELEDEMHARHPQFFE 1229 >XP_017700366.1 PREDICTED: uncharacterized protein LOC108511597 [Phoenix dactylifera] Length = 588 Score = 80.1 bits (196), Expect = 8e-15 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFD 159 +IVD+K+Q+LR RTI YVK+QW NH+EREATWELEE+MR+ HP LF+ Sbjct: 541 RIVDKKEQILRRRTIHYVKIQWTNHTEREATWELEEEMRQSHPQLFE 587 >GAV80957.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 127 Score = 74.7 bits (182), Expect = 1e-14 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDT 156 +I+D K+QVLRT+TIP VKV WRNH EATWELE+ MR+E+PHLF++ Sbjct: 78 EIMDYKEQVLRTKTIPLVKVLWRNHDMEEATWELEDTMRKEYPHLFES 125 >OMO91869.1 reverse transcriptase [Corchorus capsularis] Length = 1401 Score = 79.3 bits (194), Expect = 2e-14 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 +IVDRK+QVLR RTIP+VKVQW NH+ REATWE+EE MR+E+P+LF Sbjct: 1352 RIVDRKEQVLRRRTIPFVKVQWSNHTPREATWEMEEDMRKEYPYLF 1397 >XP_010910566.1 PREDICTED: uncharacterized protein LOC105036500, partial [Elaeis guineensis] Length = 126 Score = 73.9 bits (180), Expect = 3e-14 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 +IVD+KDQVLR R IPYVK+ W NHSEREATWELE +M+ ++P LF Sbjct: 78 RIVDKKDQVLRHRIIPYVKIHWSNHSEREATWELETEMKIKYPQLF 123 >GAV63589.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 127 Score = 73.9 bits (180), Expect = 3e-14 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 KI+D K+QVLRT+T+P VKV W+NH EATWELE+ MR+E+PHLF Sbjct: 78 KILDYKEQVLRTKTVPLVKVLWKNHEVEEATWELEDTMRQEYPHLF 123 >GAV77202.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 127 Score = 73.9 bits (180), Expect = 3e-14 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLF 162 KI+D K+QVLRT+T+P VKV W+NH EATWELE+ MR+E+PHLF Sbjct: 78 KILDYKEQVLRTKTVPLVKVLWKNHEVEEATWELEDAMRQEYPHLF 123 >GAV82008.1 Chromo domain-containing protein [Cephalotus follicularis] Length = 127 Score = 73.2 bits (178), Expect = 6e-14 Identities = 30/48 (62%), Positives = 41/48 (85%) Frame = -1 Query: 299 KIVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDT 156 KI+D K+Q+LRT+TIP VKV W+NH EATWELE+ MR+E+P+LF++ Sbjct: 78 KILDHKEQILRTKTIPLVKVLWKNHGVEEATWELEKTMRQEYPYLFES 125 >XP_020084494.1 uncharacterized protein LOC109707557 [Ananas comosus] Length = 162 Score = 73.9 bits (180), Expect = 7e-14 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = -1 Query: 296 IVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDT 156 I+DR+ + LR+R IPYVKVQW NH+ REATWELEE MR E+PHLF++ Sbjct: 114 ILDREVKKLRSRKIPYVKVQWSNHAAREATWELEETMRREYPHLFES 160 >EKG08895.1 Chromo domain-like protein [Macrophomina phaseolina MS6] Length = 162 Score = 73.9 bits (180), Expect = 7e-14 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = -1 Query: 296 IVDRKDQVLRTRTIPYVKVQWRNHSEREATWELEEKMREEHPHLFDT 156 I+DR+ + LR+R IPYVKVQW NH REATWELEE MR+E+PHLF++ Sbjct: 114 ILDREVKKLRSRKIPYVKVQWSNHDVREATWELEESMRKEYPHLFES 160