BLASTX nr result
ID: Glycyrrhiza28_contig00025783
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00025783 (270 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019420492.1 PREDICTED: uncharacterized protein LOC109330683 [... 71 5e-13 XP_016202657.1 PREDICTED: uncharacterized protein YuxK, partial ... 68 4e-12 XP_015965180.1 PREDICTED: uncharacterized protein YuxK, partial ... 68 4e-12 XP_002534526.1 PREDICTED: uncharacterized protein YuxK [Ricinus ... 67 1e-11 XP_012092041.1 PREDICTED: uncharacterized protein LOC105649843 [... 67 1e-11 XP_010272032.1 PREDICTED: uncharacterized protein LOC104607938 [... 67 1e-11 GAV69341.1 DUF393 domain-containing protein [Cephalotus follicul... 67 1e-11 OEL24582.1 hypothetical protein BAE44_0014400 [Dichanthelium oli... 67 2e-11 XP_004965093.1 PREDICTED: uncharacterized protein YuxK [Setaria ... 67 2e-11 XP_002436771.1 hypothetical protein SORBIDRAFT_10g008490 [Sorghu... 67 2e-11 XP_010043818.1 PREDICTED: uncharacterized protein LOC104432923 [... 67 2e-11 OAY64651.1 Uncharacterized protein YuxK [Ananas comosus] 67 3e-11 NP_001146539.1 nucleic acid binding protein [Zea mays] ACL54245.... 66 3e-11 ACG33609.1 nucleic acid binding protein [Zea mays] 66 3e-11 XP_020082596.1 uncharacterized protein LOC109706204 [Ananas como... 67 3e-11 XP_018815525.1 PREDICTED: uncharacterized protein LOC108987119 [... 67 3e-11 XP_015879638.1 PREDICTED: uncharacterized protein YuxK [Ziziphus... 66 3e-11 XP_011086496.1 PREDICTED: DCC family protein At1g52590, chloropl... 66 3e-11 XP_008793829.1 PREDICTED: uncharacterized protein YuxK [Phoenix ... 66 3e-11 XP_008446251.1 PREDICTED: uncharacterized protein YuxK [Cucumis ... 66 4e-11 >XP_019420492.1 PREDICTED: uncharacterized protein LOC109330683 [Lupinus angustifolius] Length = 215 Score = 70.9 bits (172), Expect = 5e-13 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +1 Query: 175 NPTLLQPRVVLYDGVCHLCHRGVKWVIRADKD 270 +P+LLQPRVVLYDGVCHLCHRGVKWVIRADKD Sbjct: 66 SPSLLQPRVVLYDGVCHLCHRGVKWVIRADKD 97 >XP_016202657.1 PREDICTED: uncharacterized protein YuxK, partial [Arachis ipaensis] Length = 199 Score = 68.2 bits (165), Expect = 4e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADKD 270 PTLLQPRVV+YDGVCHLCH GVKWVIRADKD Sbjct: 51 PTLLQPRVVVYDGVCHLCHGGVKWVIRADKD 81 >XP_015965180.1 PREDICTED: uncharacterized protein YuxK, partial [Arachis duranensis] Length = 203 Score = 68.2 bits (165), Expect = 4e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADKD 270 PTLLQPRVV+YDGVCHLCH GVKWVIRADKD Sbjct: 55 PTLLQPRVVVYDGVCHLCHGGVKWVIRADKD 85 >XP_002534526.1 PREDICTED: uncharacterized protein YuxK [Ricinus communis] EEF27856.1 conserved hypothetical protein [Ricinus communis] Length = 213 Score = 67.4 bits (163), Expect = 1e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PTLLQPRVV+YDGVCHLCHRGVKWVI+ADK Sbjct: 70 PTLLQPRVVVYDGVCHLCHRGVKWVIKADK 99 >XP_012092041.1 PREDICTED: uncharacterized protein LOC105649843 [Jatropha curcas] KDP21303.1 hypothetical protein JCGZ_21774 [Jatropha curcas] Length = 238 Score = 67.4 bits (163), Expect = 1e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PTLLQPRVV+YDGVCHLCHRGVKWVI+ADK Sbjct: 89 PTLLQPRVVVYDGVCHLCHRGVKWVIKADK 118 >XP_010272032.1 PREDICTED: uncharacterized protein LOC104607938 [Nelumbo nucifera] Length = 216 Score = 67.0 bits (162), Expect = 1e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 P+LLQPRVV+YDGVCHLCHRGVKWVIRADK Sbjct: 71 PSLLQPRVVVYDGVCHLCHRGVKWVIRADK 100 >GAV69341.1 DUF393 domain-containing protein [Cephalotus follicularis] Length = 217 Score = 67.0 bits (162), Expect = 1e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PTLLQPRVV+YDG+CHLCHRGVKWVI+ADK Sbjct: 72 PTLLQPRVVVYDGICHLCHRGVKWVIKADK 101 >OEL24582.1 hypothetical protein BAE44_0014400 [Dichanthelium oligosanthes] Length = 219 Score = 66.6 bits (161), Expect = 2e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PT+LQPRV++YDGVCHLCHRGVKWVIRADK Sbjct: 68 PTVLQPRVLIYDGVCHLCHRGVKWVIRADK 97 >XP_004965093.1 PREDICTED: uncharacterized protein YuxK [Setaria italica] KQL10090.1 hypothetical protein SETIT_007250mg [Setaria italica] Length = 219 Score = 66.6 bits (161), Expect = 2e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PT+LQPRV++YDGVCHLCHRGVKWVIRADK Sbjct: 68 PTVLQPRVLIYDGVCHLCHRGVKWVIRADK 97 >XP_002436771.1 hypothetical protein SORBIDRAFT_10g008490 [Sorghum bicolor] EER88138.1 hypothetical protein SORBI_010G097400 [Sorghum bicolor] Length = 219 Score = 66.6 bits (161), Expect = 2e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PT+LQPRV++YDGVCHLCHRGVKWVIRADK Sbjct: 68 PTVLQPRVLIYDGVCHLCHRGVKWVIRADK 97 >XP_010043818.1 PREDICTED: uncharacterized protein LOC104432923 [Eucalyptus grandis] Length = 226 Score = 66.6 bits (161), Expect = 2e-11 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +1 Query: 175 NPTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 +PT+LQPRVV+YDGVCHLCHRGVKWVI+ADK Sbjct: 76 DPTVLQPRVVVYDGVCHLCHRGVKWVIKADK 106 >OAY64651.1 Uncharacterized protein YuxK [Ananas comosus] Length = 236 Score = 66.6 bits (161), Expect = 3e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PTLLQPRVV+YDGVCHLCHRGV+WVI+ADK Sbjct: 83 PTLLQPRVVIYDGVCHLCHRGVRWVIKADK 112 >NP_001146539.1 nucleic acid binding protein [Zea mays] ACL54245.1 unknown [Zea mays] AQL00884.1 Putative thiol-disulfide oxidoreductase DCC [Zea mays] Length = 211 Score = 66.2 bits (160), Expect = 3e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PTLLQPRV++YDGVCHLCHRGVKWVIR DK Sbjct: 60 PTLLQPRVLIYDGVCHLCHRGVKWVIRTDK 89 >ACG33609.1 nucleic acid binding protein [Zea mays] Length = 211 Score = 66.2 bits (160), Expect = 3e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PTLLQPRV++YDGVCHLCHRGVKWVIR DK Sbjct: 60 PTLLQPRVLIYDGVCHLCHRGVKWVIRTDK 89 >XP_020082596.1 uncharacterized protein LOC109706204 [Ananas comosus] XP_020083046.1 uncharacterized protein LOC109706541 [Ananas comosus] Length = 241 Score = 66.6 bits (161), Expect = 3e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PTLLQPRVV+YDGVCHLCHRGV+WVI+ADK Sbjct: 83 PTLLQPRVVIYDGVCHLCHRGVRWVIKADK 112 >XP_018815525.1 PREDICTED: uncharacterized protein LOC108987119 [Juglans regia] Length = 242 Score = 66.6 bits (161), Expect = 3e-11 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PTLLQPRVV+YDGVCHLCHRGVKWVI ADK Sbjct: 93 PTLLQPRVVVYDGVCHLCHRGVKWVIEADK 122 >XP_015879638.1 PREDICTED: uncharacterized protein YuxK [Ziziphus jujuba] Length = 217 Score = 66.2 bits (160), Expect = 3e-11 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PT+LQPRVV+YDGVCHLCHRGVKWVI+ADK Sbjct: 71 PTILQPRVVVYDGVCHLCHRGVKWVIQADK 100 >XP_011086496.1 PREDICTED: DCC family protein At1g52590, chloroplastic [Sesamum indicum] Length = 217 Score = 66.2 bits (160), Expect = 3e-11 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADKD 270 PTLLQPRVV+YDGVCHLCH GVKWVI ADKD Sbjct: 66 PTLLQPRVVVYDGVCHLCHGGVKWVIEADKD 96 >XP_008793829.1 PREDICTED: uncharacterized protein YuxK [Phoenix dactylifera] Length = 217 Score = 66.2 bits (160), Expect = 3e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PTLLQPRVV+YDGVCHLCHRGVKWVI+ DK Sbjct: 66 PTLLQPRVVIYDGVCHLCHRGVKWVIKVDK 95 >XP_008446251.1 PREDICTED: uncharacterized protein YuxK [Cucumis melo] Length = 242 Score = 66.2 bits (160), Expect = 4e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 178 PTLLQPRVVLYDGVCHLCHRGVKWVIRADK 267 PTLLQPRVV+YDGVCHLCHRGVKWVI+ DK Sbjct: 94 PTLLQPRVVIYDGVCHLCHRGVKWVIKVDK 123