BLASTX nr result
ID: Glycyrrhiza28_contig00025706
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00025706 (335 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW12673.1 hypothetical protein TanjilG_24606 [Lupinus angustifo... 70 4e-13 GAU40758.1 hypothetical protein TSUD_26380 [Trifolium subterraneum] 72 1e-12 XP_016184330.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 5e-12 XP_015950931.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 5e-12 XP_003590654.2 PPR containing plant protein [Medicago truncatula... 70 7e-12 KYP55564.1 hypothetical protein KK1_001781 [Cajanus cajan] 70 9e-12 OIW12672.1 hypothetical protein TanjilG_24605 [Lupinus angustifo... 70 9e-12 XP_019441841.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 9e-12 XP_004495206.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 2e-11 KHN03794.1 Pentatricopeptide repeat-containing protein, mitochon... 69 3e-11 XP_003536907.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 3e-11 XP_007144631.1 hypothetical protein PHAVU_007G171700g [Phaseolus... 68 6e-11 XP_014511291.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 1e-10 XP_007050629.2 PREDICTED: pentatricopeptide repeat-containing pr... 64 9e-10 EOX94786.1 Pentatricopeptide repeat (PPR) superfamily protein [T... 64 9e-10 OAY61676.1 hypothetical protein MANES_01G208100 [Manihot esculenta] 64 9e-10 KOM35019.1 hypothetical protein LR48_Vigan02g116900 [Vigna angul... 63 2e-09 XP_017413407.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-09 GAV89497.1 PPR domain-containing protein/PPR_2 domain-containing... 62 4e-09 XP_008345197.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 1e-08 >OIW12673.1 hypothetical protein TanjilG_24606 [Lupinus angustifolius] Length = 133 Score = 70.1 bits (170), Expect = 4e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK PLIV+ERMK DNVQLDEETHRLL LTSKMCV + SRIL Sbjct: 92 GKMPLIVAERMKTDNVQLDEETHRLLNLTSKMCVGDASRIL 132 >GAU40758.1 hypothetical protein TSUD_26380 [Trifolium subterraneum] Length = 513 Score = 72.4 bits (176), Expect = 1e-12 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK PLIV+ERMKKDNVQLDEETHRLL LTSKMCVS+VS IL Sbjct: 472 GKMPLIVAERMKKDNVQLDEETHRLLDLTSKMCVSDVSGIL 512 >XP_016184330.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Arachis ipaensis] Length = 528 Score = 70.9 bits (172), Expect = 5e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK PLIV+ERMKKDNVQLDEETHRLL LTSKMCVS+ S IL Sbjct: 478 GKMPLIVAERMKKDNVQLDEETHRLLDLTSKMCVSDASLIL 518 >XP_015950931.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Arachis duranensis] Length = 528 Score = 70.9 bits (172), Expect = 5e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK PLIV+ERMKKDNVQLDEETHRLL LTSKMCVS+ S IL Sbjct: 478 GKMPLIVAERMKKDNVQLDEETHRLLDLTSKMCVSDASLIL 518 >XP_003590654.2 PPR containing plant protein [Medicago truncatula] AES60905.2 PPR containing plant protein [Medicago truncatula] Length = 512 Score = 70.5 bits (171), Expect = 7e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK PL+V+ERMKKDNVQLD+ETHRLL LTSKMCVS+VS IL Sbjct: 471 GKMPLVVAERMKKDNVQLDKETHRLLDLTSKMCVSDVSGIL 511 >KYP55564.1 hypothetical protein KK1_001781 [Cajanus cajan] Length = 508 Score = 70.1 bits (170), Expect = 9e-12 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRILH 128 GK PL+V+ERM+KDNV+LDEET+RLL LTSKMCVS+VSRIL+ Sbjct: 467 GKMPLVVAERMRKDNVKLDEETNRLLDLTSKMCVSDVSRILY 508 >OIW12672.1 hypothetical protein TanjilG_24605 [Lupinus angustifolius] Length = 515 Score = 70.1 bits (170), Expect = 9e-12 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK PLIV+ERMK DNVQLDEETHRLL LTSKMCV + SRIL Sbjct: 474 GKMPLIVAERMKTDNVQLDEETHRLLNLTSKMCVGDASRIL 514 >XP_019441841.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial isoform X1 [Lupinus angustifolius] XP_019441842.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial isoform X2 [Lupinus angustifolius] Length = 518 Score = 70.1 bits (170), Expect = 9e-12 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK PLIV+ERMK DNVQLDEETHRLL LTSKMCV + SRIL Sbjct: 477 GKMPLIVAERMKTDNVQLDEETHRLLNLTSKMCVGDASRIL 517 >XP_004495206.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Cicer arietinum] Length = 510 Score = 69.3 bits (168), Expect = 2e-11 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK PLIV+ERMKKDNVQLDEETHRLL LTSKMCV +VS L Sbjct: 469 GKMPLIVTERMKKDNVQLDEETHRLLDLTSKMCVGDVSGFL 509 >KHN03794.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 414 Score = 68.6 bits (166), Expect = 3e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK P+IV+ERM+KDNV+LDEET RLL LTSKMCVS+VSRIL Sbjct: 373 GKMPMIVAERMRKDNVKLDEETRRLLDLTSKMCVSDVSRIL 413 >XP_003536907.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Glycine max] Length = 516 Score = 68.6 bits (166), Expect = 3e-11 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK P+IV+ERM+KDNV+LDEET RLL LTSKMCVS+VSRIL Sbjct: 475 GKMPMIVAERMRKDNVKLDEETRRLLDLTSKMCVSDVSRIL 515 >XP_007144631.1 hypothetical protein PHAVU_007G171700g [Phaseolus vulgaris] ESW16625.1 hypothetical protein PHAVU_007G171700g [Phaseolus vulgaris] Length = 511 Score = 67.8 bits (164), Expect = 6e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRI 122 GK PLIV+ERM+KDNV+LDEET RLL LTSKMCVS+VSRI Sbjct: 470 GKMPLIVAERMRKDNVKLDEETQRLLDLTSKMCVSDVSRI 509 >XP_014511291.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Vigna radiata var. radiata] Length = 512 Score = 66.6 bits (161), Expect = 1e-10 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK PLIV ERM+KDNV+ DEET RLL LTSKMCVSNVSR L Sbjct: 471 GKMPLIVEERMRKDNVKFDEETRRLLDLTSKMCVSNVSRNL 511 >XP_007050629.2 PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Theobroma cacao] Length = 513 Score = 64.3 bits (155), Expect = 9e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK PLIV+ERM+KDNV LDEETH L+ LTSKMCVS VS L Sbjct: 473 GKMPLIVAERMRKDNVPLDEETHELINLTSKMCVSEVSSSL 513 >EOX94786.1 Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 513 Score = 64.3 bits (155), Expect = 9e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK PLIV+ERM+KDNV LDEETH L+ LTSKMCVS VS L Sbjct: 473 GKMPLIVAERMRKDNVPLDEETHELINLTSKMCVSEVSSSL 513 >OAY61676.1 hypothetical protein MANES_01G208100 [Manihot esculenta] Length = 514 Score = 64.3 bits (155), Expect = 9e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVS 116 GK PLI++ERMKKDNV+LDEETHRL+ +TS MCVS VS Sbjct: 473 GKMPLIIAERMKKDNVELDEETHRLIQITSSMCVSEVS 510 >KOM35019.1 hypothetical protein LR48_Vigan02g116900 [Vigna angularis] Length = 504 Score = 63.2 bits (152), Expect = 2e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK PLIV+ERM+KDNV+ DEET RLL LTSKMCV +VSR L Sbjct: 463 GKMPLIVAERMRKDNVKFDEETQRLLDLTSKMCVCDVSRNL 503 >XP_017413407.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial [Vigna angularis] BAT95605.1 hypothetical protein VIGAN_08236200 [Vigna angularis var. angularis] Length = 512 Score = 63.2 bits (152), Expect = 2e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRIL 125 GK PLIV+ERM+KDNV+ DEET RLL LTSKMCV +VSR L Sbjct: 471 GKMPLIVAERMRKDNVKFDEETQRLLDLTSKMCVCDVSRNL 511 >GAV89497.1 PPR domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 519 Score = 62.4 bits (150), Expect = 4e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVS 116 GK PLIV+ERMK+DNVQLDEETH L+ +TS+MCVS +S Sbjct: 478 GKMPLIVAERMKQDNVQLDEETHNLIKITSQMCVSEIS 515 >XP_008345197.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02820, mitochondrial-like, partial [Malus domestica] Length = 424 Score = 61.2 bits (147), Expect = 1e-08 Identities = 26/40 (65%), Positives = 36/40 (90%) Frame = +3 Query: 3 GKRPLIVSERMKKDNVQLDEETHRLLGLTSKMCVSNVSRI 122 GK PL+++ERM+KDNVQLD+ET +L+ +TSKMCVS++S I Sbjct: 383 GKMPLVIAERMEKDNVQLDDETRKLIKITSKMCVSDISSI 422