BLASTX nr result
ID: Glycyrrhiza28_contig00025702
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00025702 (312 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004485453.1 PREDICTED: tRNA pseudouridine synthase-like 1 iso... 119 5e-30 KYP63212.1 tRNA pseudouridine synthase A [Cajanus cajan] 117 1e-29 KRH26319.1 hypothetical protein GLYMA_12G167000 [Glycine max] 117 2e-29 XP_003540148.1 PREDICTED: tRNA pseudouridine synthase A-like [Gl... 117 2e-29 XP_016197290.1 PREDICTED: tRNA pseudouridine synthase A [Arachis... 117 2e-29 XP_015958795.1 PREDICTED: tRNA pseudouridine synthase A [Arachis... 117 2e-29 XP_006598748.1 PREDICTED: uncharacterized protein LOC100799818 i... 116 3e-29 KHN39669.1 tRNA pseudouridine synthase A [Glycine soja] KRH06072... 116 4e-29 NP_001242177.1 uncharacterized protein LOC100799818 [Glycine max... 116 4e-29 XP_007148560.1 hypothetical protein PHAVU_006G218900g [Phaseolus... 116 5e-29 XP_007148561.1 hypothetical protein PHAVU_006G218900g [Phaseolus... 116 5e-29 XP_017413274.1 PREDICTED: tRNA pseudouridine synthase A isoform ... 114 9e-29 KOM31720.1 hypothetical protein LR48_Vigan01g127500 [Vigna angul... 114 1e-28 XP_017413265.1 PREDICTED: tRNA pseudouridine synthase A isoform ... 114 2e-28 XP_017413257.1 PREDICTED: tRNA pseudouridine synthase A isoform ... 114 2e-28 XP_014517831.1 PREDICTED: tRNA pseudouridine synthase A isoform ... 114 2e-28 XP_003592926.2 tRNA pseudouridine synthase A [Medicago truncatul... 114 2e-28 XP_014517830.1 PREDICTED: tRNA pseudouridine synthase A isoform ... 114 3e-28 XP_007222086.1 hypothetical protein PRUPE_ppa007576m1g, partial ... 110 4e-28 XP_009353753.1 PREDICTED: uncharacterized protein LOC103944983 i... 111 2e-27 >XP_004485453.1 PREDICTED: tRNA pseudouridine synthase-like 1 isoform X1 [Cicer arietinum] Length = 374 Score = 119 bits (297), Expect = 5e-30 Identities = 58/60 (96%), Positives = 59/60 (98%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 R+FLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTA SPMAPACGLYLGEVKYDLPS Sbjct: 315 RAFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTAASPMAPACGLYLGEVKYDLPS 374 >KYP63212.1 tRNA pseudouridine synthase A [Cajanus cajan] Length = 367 Score = 117 bits (294), Expect = 1e-29 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 R+FLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTA SPMAPACGLYLGEVKYDLP+ Sbjct: 307 RAFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTAASPMAPACGLYLGEVKYDLPN 366 >KRH26319.1 hypothetical protein GLYMA_12G167000 [Glycine max] Length = 368 Score = 117 bits (293), Expect = 2e-29 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 RSFLYHQVRLLVGVLKA GTGNLTIPDVERILNAKTVTA SPMAPACGLYLGEVKYDLP+ Sbjct: 308 RSFLYHQVRLLVGVLKAAGTGNLTIPDVERILNAKTVTAASPMAPACGLYLGEVKYDLPT 367 >XP_003540148.1 PREDICTED: tRNA pseudouridine synthase A-like [Glycine max] KHN31590.1 tRNA pseudouridine synthase A [Glycine soja] KRH26320.1 hypothetical protein GLYMA_12G167000 [Glycine max] Length = 369 Score = 117 bits (293), Expect = 2e-29 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 RSFLYHQVRLLVGVLKA GTGNLTIPDVERILNAKTVTA SPMAPACGLYLGEVKYDLP+ Sbjct: 309 RSFLYHQVRLLVGVLKAAGTGNLTIPDVERILNAKTVTAASPMAPACGLYLGEVKYDLPT 368 >XP_016197290.1 PREDICTED: tRNA pseudouridine synthase A [Arachis ipaensis] Length = 356 Score = 117 bits (292), Expect = 2e-29 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 RSFLYHQVRLLVGVLK VGTGNLTIPDVERILNAKT+TA SPMAPACGLYLGEVKYDLP+ Sbjct: 297 RSFLYHQVRLLVGVLKVVGTGNLTIPDVERILNAKTITAASPMAPACGLYLGEVKYDLPN 356 >XP_015958795.1 PREDICTED: tRNA pseudouridine synthase A [Arachis duranensis] Length = 356 Score = 117 bits (292), Expect = 2e-29 Identities = 56/60 (93%), Positives = 58/60 (96%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 RSFLYHQVRLLVGVLK VGTGNLTIPDVERILNAKT+TA SPMAPACGLYLGEVKYDLP+ Sbjct: 297 RSFLYHQVRLLVGVLKVVGTGNLTIPDVERILNAKTITAASPMAPACGLYLGEVKYDLPN 356 >XP_006598748.1 PREDICTED: uncharacterized protein LOC100799818 isoform X1 [Glycine max] KRH06071.1 hypothetical protein GLYMA_16G003100 [Glycine max] Length = 349 Score = 116 bits (291), Expect = 3e-29 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 R+FLYHQVRLLVGVLKAVGTGNLTIPDVERILNA+TVTA SPMAPACGLYLGEVKYDLP+ Sbjct: 289 RAFLYHQVRLLVGVLKAVGTGNLTIPDVERILNARTVTAASPMAPACGLYLGEVKYDLPT 348 >KHN39669.1 tRNA pseudouridine synthase A [Glycine soja] KRH06072.1 hypothetical protein GLYMA_16G003100 [Glycine max] Length = 370 Score = 116 bits (291), Expect = 4e-29 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 R+FLYHQVRLLVGVLKAVGTGNLTIPDVERILNA+TVTA SPMAPACGLYLGEVKYDLP+ Sbjct: 310 RAFLYHQVRLLVGVLKAVGTGNLTIPDVERILNARTVTAASPMAPACGLYLGEVKYDLPT 369 >NP_001242177.1 uncharacterized protein LOC100799818 [Glycine max] ACU18919.1 unknown [Glycine max] Length = 370 Score = 116 bits (291), Expect = 4e-29 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 R+FLYHQVRLLVGVLKAVGTGNLTIPDVERILNA+TVTA SPMAPACGLYLGEVKYDLP+ Sbjct: 310 RAFLYHQVRLLVGVLKAVGTGNLTIPDVERILNARTVTAASPMAPACGLYLGEVKYDLPT 369 >XP_007148560.1 hypothetical protein PHAVU_006G218900g [Phaseolus vulgaris] ESW20554.1 hypothetical protein PHAVU_006G218900g [Phaseolus vulgaris] Length = 372 Score = 116 bits (290), Expect = 5e-29 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAK+VT+ SPMAPACGLYLGEVKYDLP+ Sbjct: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKSVTSASPMAPACGLYLGEVKYDLPT 371 >XP_007148561.1 hypothetical protein PHAVU_006G218900g [Phaseolus vulgaris] ESW20555.1 hypothetical protein PHAVU_006G218900g [Phaseolus vulgaris] Length = 373 Score = 116 bits (290), Expect = 5e-29 Identities = 56/60 (93%), Positives = 59/60 (98%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAK+VT+ SPMAPACGLYLGEVKYDLP+ Sbjct: 313 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKSVTSASPMAPACGLYLGEVKYDLPT 372 >XP_017413274.1 PREDICTED: tRNA pseudouridine synthase A isoform X3 [Vigna angularis] Length = 321 Score = 114 bits (286), Expect = 9e-29 Identities = 55/60 (91%), Positives = 59/60 (98%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 RSFLYHQVRLLVGVLKAVG+GNLTIPDVERILNAK+VT+ SPMAPACGLYLGEVKYDLP+ Sbjct: 261 RSFLYHQVRLLVGVLKAVGSGNLTIPDVERILNAKSVTSASPMAPACGLYLGEVKYDLPT 320 >KOM31720.1 hypothetical protein LR48_Vigan01g127500 [Vigna angularis] Length = 330 Score = 114 bits (286), Expect = 1e-28 Identities = 55/60 (91%), Positives = 59/60 (98%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 RSFLYHQVRLLVGVLKAVG+GNLTIPDVERILNAK+VT+ SPMAPACGLYLGEVKYDLP+ Sbjct: 270 RSFLYHQVRLLVGVLKAVGSGNLTIPDVERILNAKSVTSASPMAPACGLYLGEVKYDLPT 329 >XP_017413265.1 PREDICTED: tRNA pseudouridine synthase A isoform X2 [Vigna angularis] Length = 357 Score = 114 bits (286), Expect = 2e-28 Identities = 55/60 (91%), Positives = 59/60 (98%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 RSFLYHQVRLLVGVLKAVG+GNLTIPDVERILNAK+VT+ SPMAPACGLYLGEVKYDLP+ Sbjct: 297 RSFLYHQVRLLVGVLKAVGSGNLTIPDVERILNAKSVTSASPMAPACGLYLGEVKYDLPT 356 >XP_017413257.1 PREDICTED: tRNA pseudouridine synthase A isoform X1 [Vigna angularis] Length = 368 Score = 114 bits (286), Expect = 2e-28 Identities = 55/60 (91%), Positives = 59/60 (98%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 RSFLYHQVRLLVGVLKAVG+GNLTIPDVERILNAK+VT+ SPMAPACGLYLGEVKYDLP+ Sbjct: 308 RSFLYHQVRLLVGVLKAVGSGNLTIPDVERILNAKSVTSASPMAPACGLYLGEVKYDLPT 367 >XP_014517831.1 PREDICTED: tRNA pseudouridine synthase A isoform X2 [Vigna radiata var. radiata] Length = 359 Score = 114 bits (285), Expect = 2e-28 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 RSFLYHQVRLLVGVLKAVG+GNLTIPDVERILNAK VT+ SPMAPACGLYLGEVKYDLP+ Sbjct: 299 RSFLYHQVRLLVGVLKAVGSGNLTIPDVERILNAKNVTSASPMAPACGLYLGEVKYDLPT 358 >XP_003592926.2 tRNA pseudouridine synthase A [Medicago truncatula] ABE79574.2 tRNA pseudouridine synthase [Medicago truncatula] AES63177.2 tRNA pseudouridine synthase A [Medicago truncatula] Length = 361 Score = 114 bits (285), Expect = 2e-28 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 R+FLYHQVRLLVGVLK VGTGN+T+ DVERILNAKTVTATSPMAPACGLYLGEVKYDLPS Sbjct: 302 RAFLYHQVRLLVGVLKDVGTGNITVTDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 361 >XP_014517830.1 PREDICTED: tRNA pseudouridine synthase A isoform X1 [Vigna radiata var. radiata] Length = 370 Score = 114 bits (285), Expect = 3e-28 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLPS 133 RSFLYHQVRLLVGVLKAVG+GNLTIPDVERILNAK VT+ SPMAPACGLYLGEVKYDLP+ Sbjct: 310 RSFLYHQVRLLVGVLKAVGSGNLTIPDVERILNAKNVTSASPMAPACGLYLGEVKYDLPT 369 >XP_007222086.1 hypothetical protein PRUPE_ppa007576m1g, partial [Prunus persica] Length = 234 Score = 110 bits (276), Expect = 4e-28 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLP 136 R+FLYHQVRLLVGVLKAVGTG+L +PDVERILNAKTVTA SPMAPACGLYLG VKYDLP Sbjct: 176 RAFLYHQVRLLVGVLKAVGTGDLKVPDVERILNAKTVTAASPMAPACGLYLGHVKYDLP 234 >XP_009353753.1 PREDICTED: uncharacterized protein LOC103944983 isoform X3 [Pyrus x bretschneideri] Length = 317 Score = 111 bits (277), Expect = 2e-27 Identities = 53/59 (89%), Positives = 56/59 (94%) Frame = -1 Query: 312 RSFLYHQVRLLVGVLKAVGTGNLTIPDVERILNAKTVTATSPMAPACGLYLGEVKYDLP 136 RSFLYHQVRLLVGVLK VGTG+L +PDVERILNAKTVTA SPMAPACGLYLG+VKYDLP Sbjct: 259 RSFLYHQVRLLVGVLKCVGTGDLKVPDVERILNAKTVTAASPMAPACGLYLGQVKYDLP 317