BLASTX nr result
ID: Glycyrrhiza28_contig00025616
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00025616 (333 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT57571.1 Double-stranded RNA-binding protein 6, partial [Anthu... 79 5e-15 KZN05601.1 hypothetical protein DCAR_006438 [Daucus carota subsp... 70 1e-13 CDO99741.1 unnamed protein product [Coffea canephora] 71 1e-13 JAU24718.1 Double-stranded RNA-binding protein 5, partial [Nocca... 72 2e-13 XP_016481606.1 PREDICTED: double-stranded RNA-binding protein 2-... 71 2e-13 XP_007206726.1 hypothetical protein PRUPE_ppa024708mg, partial [... 74 4e-13 XP_018834097.1 PREDICTED: double-stranded RNA-binding protein 2 ... 73 1e-12 KYP68532.1 Ribonuclease 3 [Cajanus cajan] 70 1e-12 CAN71476.1 hypothetical protein VITISV_038619 [Vitis vinifera] 73 1e-12 XP_010231695.1 PREDICTED: double-stranded RNA-binding protein 2-... 73 1e-12 KCW51388.1 hypothetical protein EUGRSUZ_J00927, partial [Eucalyp... 72 1e-12 XP_006447006.1 hypothetical protein CICLE_v10016468mg [Citrus cl... 71 1e-12 KNA17177.1 hypothetical protein SOVF_082520, partial [Spinacia o... 69 1e-12 KZV54829.1 Double-stranded RNA-binding protein 2, partial [Dorco... 69 1e-12 OAP06395.1 hypothetical protein AXX17_AT3G29340 [Arabidopsis tha... 67 2e-12 JAU29426.1 Double-stranded RNA-binding protein 5, partial [Nocca... 72 2e-12 CBI16317.3 unnamed protein product, partial [Vitis vinifera] 71 2e-12 KYP68453.1 hypothetical protein KK1_022079 [Cajanus cajan] 70 2e-12 KQK88684.1 hypothetical protein SETIT_034815mg [Setaria italica] 72 3e-12 KVH90768.1 Double-stranded RNA-binding [Cynara cardunculus var. ... 71 3e-12 >JAT57571.1 Double-stranded RNA-binding protein 6, partial [Anthurium amnicola] Length = 495 Score = 79.3 bits (194), Expect = 5e-15 Identities = 37/41 (90%), Positives = 37/41 (90%) Frame = +1 Query: 211 RERESEGDRKMYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 RERE EG MYKNQLQELAQRSCFNLPSYTCIREGPDHAP Sbjct: 1 REREREGIIIMYKNQLQELAQRSCFNLPSYTCIREGPDHAP 41 >KZN05601.1 hypothetical protein DCAR_006438 [Daucus carota subsp. sativus] Length = 83 Score = 70.1 bits (170), Expect = 1e-13 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 241 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 MYKNQLQELAQRSCFNLP+YTCIREGPDHAP Sbjct: 1 MYKNQLQELAQRSCFNLPAYTCIREGPDHAP 31 >CDO99741.1 unnamed protein product [Coffea canephora] Length = 128 Score = 71.2 bits (173), Expect = 1e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 241 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP Sbjct: 1 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 31 >JAU24718.1 Double-stranded RNA-binding protein 5, partial [Noccaea caerulescens] Length = 170 Score = 72.0 bits (175), Expect = 2e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 235 RKMYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 +KMYKNQLQELAQRSCF+LPSYTCIREGPDHAP Sbjct: 8 KKMYKNQLQELAQRSCFSLPSYTCIREGPDHAP 40 >XP_016481606.1 PREDICTED: double-stranded RNA-binding protein 2-like [Nicotiana tabacum] Length = 157 Score = 71.2 bits (173), Expect = 2e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 241 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP Sbjct: 1 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 31 >XP_007206726.1 hypothetical protein PRUPE_ppa024708mg, partial [Prunus persica] Length = 465 Score = 73.9 bits (180), Expect = 4e-13 Identities = 37/48 (77%), Positives = 39/48 (81%), Gaps = 5/48 (10%) Frame = +1 Query: 205 WKRERESEG-DR----KMYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 W+ E E E DR +MYKNQLQELAQRSCFNLPSYTCIREGPDHAP Sbjct: 77 WETESERERQDRVRGGEMYKNQLQELAQRSCFNLPSYTCIREGPDHAP 124 >XP_018834097.1 PREDICTED: double-stranded RNA-binding protein 2 [Juglans regia] Length = 508 Score = 72.8 bits (177), Expect = 1e-12 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +1 Query: 220 ESEGDRKMYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 E G+ MYKNQLQELAQRSCFNLPSY CIREGPDHAP Sbjct: 15 EKSGEVDMYKNQLQELAQRSCFNLPSYACIREGPDHAP 52 >KYP68532.1 Ribonuclease 3 [Cajanus cajan] Length = 194 Score = 70.5 bits (171), Expect = 1e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 241 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 MYKNQLQELAQRSCFN+PSYTCIREGPDHAP Sbjct: 1 MYKNQLQELAQRSCFNIPSYTCIREGPDHAP 31 >CAN71476.1 hypothetical protein VITISV_038619 [Vitis vinifera] Length = 552 Score = 72.8 bits (177), Expect = 1e-12 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +1 Query: 217 RESEGDRKMYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 RE G+ M+KNQLQELAQRSCFNLPSY CIREGPDHAP Sbjct: 64 REKTGEVDMFKNQLQELAQRSCFNLPSYACIREGPDHAP 102 >XP_010231695.1 PREDICTED: double-stranded RNA-binding protein 2-like [Brachypodium distachyon] Length = 742 Score = 72.8 bits (177), Expect = 1e-12 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 223 SEGDRKMYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 SE D MYKNQLQELAQRSCFNLPSY CIREGPDHAP Sbjct: 178 SEVDAGMYKNQLQELAQRSCFNLPSYACIREGPDHAP 214 >KCW51388.1 hypothetical protein EUGRSUZ_J00927, partial [Eucalyptus grandis] Length = 302 Score = 72.0 bits (175), Expect = 1e-12 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = +1 Query: 226 EGDRKMYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 EG MYKNQLQELAQRSCFNLPSY CIREGPDHAP Sbjct: 87 EGGGDMYKNQLQELAQRSCFNLPSYACIREGPDHAP 122 >XP_006447006.1 hypothetical protein CICLE_v10016468mg [Citrus clementina] ESR60246.1 hypothetical protein CICLE_v10016468mg [Citrus clementina] Length = 240 Score = 71.2 bits (173), Expect = 1e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 241 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP Sbjct: 1 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 31 >KNA17177.1 hypothetical protein SOVF_082520, partial [Spinacia oleracea] Length = 155 Score = 69.3 bits (168), Expect = 1e-12 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 241 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 MYKNQLQELAQRSCFNLPSY CIREGPDHAP Sbjct: 1 MYKNQLQELAQRSCFNLPSYACIREGPDHAP 31 >KZV54829.1 Double-stranded RNA-binding protein 2, partial [Dorcoceras hygrometricum] Length = 158 Score = 69.3 bits (168), Expect = 1e-12 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +1 Query: 238 KMYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 +MYKNQLQELAQRSCF+LPSYTC+REGPDHAP Sbjct: 1 EMYKNQLQELAQRSCFSLPSYTCVREGPDHAP 32 >OAP06395.1 hypothetical protein AXX17_AT3G29340 [Arabidopsis thaliana] Length = 88 Score = 67.4 bits (163), Expect = 2e-12 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 241 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 MYKNQLQELAQRSCF+LPSYTC REGPDHAP Sbjct: 1 MYKNQLQELAQRSCFSLPSYTCTREGPDHAP 31 >JAU29426.1 Double-stranded RNA-binding protein 5, partial [Noccaea caerulescens] Length = 384 Score = 72.0 bits (175), Expect = 2e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +1 Query: 235 RKMYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 +KMYKNQLQELAQRSCF+LPSYTCIREGPDHAP Sbjct: 5 KKMYKNQLQELAQRSCFSLPSYTCIREGPDHAP 37 >CBI16317.3 unnamed protein product, partial [Vitis vinifera] Length = 280 Score = 71.2 bits (173), Expect = 2e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 241 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP Sbjct: 1 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 31 >KYP68453.1 hypothetical protein KK1_022079 [Cajanus cajan] Length = 247 Score = 70.5 bits (171), Expect = 2e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 241 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 MYKNQLQELAQRSCFN+PSYTCIREGPDHAP Sbjct: 1 MYKNQLQELAQRSCFNIPSYTCIREGPDHAP 31 >KQK88684.1 hypothetical protein SETIT_034815mg [Setaria italica] Length = 591 Score = 71.6 bits (174), Expect = 3e-12 Identities = 33/42 (78%), Positives = 35/42 (83%), Gaps = 2/42 (4%) Frame = +1 Query: 214 ERESEGDRK--MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 ER G R MYKNQLQELAQRSCFNLP+YTC+REGPDHAP Sbjct: 63 ERRGSGRRSAAMYKNQLQELAQRSCFNLPAYTCLREGPDHAP 104 >KVH90768.1 Double-stranded RNA-binding [Cynara cardunculus var. scolymus] Length = 364 Score = 71.2 bits (173), Expect = 3e-12 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 241 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 333 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP Sbjct: 1 MYKNQLQELAQRSCFNLPSYTCIREGPDHAP 31