BLASTX nr result
ID: Glycyrrhiza28_contig00025281
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00025281 (281 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU23841.1 hypothetical protein TSUD_380030 [Trifolium subterran... 60 4e-10 >GAU23841.1 hypothetical protein TSUD_380030 [Trifolium subterraneum] Length = 60 Score = 59.7 bits (143), Expect = 4e-10 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -2 Query: 274 LE*SVKRAAATKTTTQEREAEKRISSFQLNLLATWRLFTPLAAIPHS 134 LE + K+A ATKTTTQ+ E EKRISS QLNL+ TWR FT LAAI +S Sbjct: 3 LELTEKKANATKTTTQKIETEKRISSLQLNLVDTWRRFTVLAAISNS 49