BLASTX nr result
ID: Glycyrrhiza28_contig00025217
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00025217 (256 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007161203.1 hypothetical protein PHAVU_001G050800g [Phaseolus... 57 1e-07 XP_014504401.1 PREDICTED: uncharacterized protein LOC106764622 i... 57 1e-07 XP_014504400.1 PREDICTED: uncharacterized protein LOC106764622 i... 57 1e-07 XP_017411068.1 PREDICTED: uncharacterized protein LOC108323208 i... 55 4e-07 XP_017411067.1 PREDICTED: uncharacterized protein LOC108323208 i... 55 4e-07 BAT82332.1 hypothetical protein VIGAN_03233300 [Vigna angularis ... 55 4e-07 KOM30119.1 hypothetical protein LR48_Vigan909s000400 [Vigna angu... 55 4e-07 >XP_007161203.1 hypothetical protein PHAVU_001G050800g [Phaseolus vulgaris] ESW33197.1 hypothetical protein PHAVU_001G050800g [Phaseolus vulgaris] Length = 257 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 34 RKTTTKSRILIPSTIPRCLLGSFRKIRRIVCFG 132 R+TTTK+RI PSTIPRCLLGSFRKIR IVCFG Sbjct: 211 RRTTTKNRIW-PSTIPRCLLGSFRKIRSIVCFG 242 >XP_014504401.1 PREDICTED: uncharacterized protein LOC106764622 isoform X2 [Vigna radiata var. radiata] Length = 266 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 34 RKTTTKSRILIPSTIPRCLLGSFRKIRRIVCFG 132 R+TTTKSRI PSTIPRCL+GSFRKIR IVCFG Sbjct: 220 RRTTTKSRIW-PSTIPRCLVGSFRKIRSIVCFG 251 >XP_014504400.1 PREDICTED: uncharacterized protein LOC106764622 isoform X1 [Vigna radiata var. radiata] Length = 268 Score = 56.6 bits (135), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 34 RKTTTKSRILIPSTIPRCLLGSFRKIRRIVCFG 132 R+TTTKSRI PSTIPRCL+GSFRKIR IVCFG Sbjct: 222 RRTTTKSRIW-PSTIPRCLVGSFRKIRSIVCFG 253 >XP_017411068.1 PREDICTED: uncharacterized protein LOC108323208 isoform X2 [Vigna angularis] Length = 265 Score = 55.5 bits (132), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 34 RKTTTKSRILIPSTIPRCLLGSFRKIRRIVCFG 132 R+TTTKSRI PSTIPRCL+GSFRKI+ IVCFG Sbjct: 219 RRTTTKSRIW-PSTIPRCLVGSFRKIKSIVCFG 250 >XP_017411067.1 PREDICTED: uncharacterized protein LOC108323208 isoform X1 [Vigna angularis] Length = 267 Score = 55.5 bits (132), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 34 RKTTTKSRILIPSTIPRCLLGSFRKIRRIVCFG 132 R+TTTKSRI PSTIPRCL+GSFRKI+ IVCFG Sbjct: 221 RRTTTKSRIW-PSTIPRCLVGSFRKIKSIVCFG 252 >BAT82332.1 hypothetical protein VIGAN_03233300 [Vigna angularis var. angularis] Length = 267 Score = 55.5 bits (132), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 34 RKTTTKSRILIPSTIPRCLLGSFRKIRRIVCFG 132 R+TTTKSRI PSTIPRCL+GSFRKI+ IVCFG Sbjct: 221 RRTTTKSRIW-PSTIPRCLVGSFRKIKSIVCFG 252 >KOM30119.1 hypothetical protein LR48_Vigan909s000400 [Vigna angularis] Length = 293 Score = 55.5 bits (132), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 34 RKTTTKSRILIPSTIPRCLLGSFRKIRRIVCFG 132 R+TTTKSRI PSTIPRCL+GSFRKI+ IVCFG Sbjct: 247 RRTTTKSRIW-PSTIPRCLVGSFRKIKSIVCFG 278