BLASTX nr result
ID: Glycyrrhiza28_contig00025162
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00025162 (360 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU24540.1 hypothetical protein TSUD_156530 [Trifolium subterran... 56 1e-06 >GAU24540.1 hypothetical protein TSUD_156530 [Trifolium subterraneum] Length = 1147 Score = 55.8 bits (133), Expect = 1e-06 Identities = 35/121 (28%), Positives = 54/121 (44%), Gaps = 3/121 (2%) Frame = -2 Query: 359 KTIPHCLFGYAIAKRVWQACGFQGLDLTASTSSLHQWLHDLVVQEGTSCLVILWVIWCA* 180 +TI HCLF A +W+ACG + + ++ L W D+ G +I+W +WC+ Sbjct: 875 ETIVHCLFACTDAIGIWRACGLEHVLPPSTDVDLFCWCRDVGKSHGCIIFIIMWFVWCSR 934 Query: 179 NLHIF*GTVVVPAELFSKVYPLTHHIHHAFWDMVALAHPPCE---VSWIWAGEDVFVLNV 9 N IF + L +KV+ + AF + + + E V W E LNV Sbjct: 935 NDAIFNNNKAIVHNLVAKVHYMLSFCTAAFENTTSGSGGNSEHRLVVWPRPDEGTVCLNV 994 Query: 8 D 6 D Sbjct: 995 D 995