BLASTX nr result
ID: Glycyrrhiza28_contig00025128
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00025128 (382 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004488701.1 PREDICTED: probable caffeoyl-CoA O-methyltransfer... 62 8e-09 GAU19075.1 hypothetical protein TSUD_99370 [Trifolium subterraneum] 58 2e-07 >XP_004488701.1 PREDICTED: probable caffeoyl-CoA O-methyltransferase At4g26220 [Cicer arietinum] Length = 297 Score = 62.0 bits (149), Expect = 8e-09 Identities = 30/55 (54%), Positives = 41/55 (74%) Frame = +1 Query: 217 MVIMANRSINLAFHHGSMLPSEPATLVLRPVRLFASFHSFSATGAVTTSASKSLR 381 +V+M + SINL HHG+MLP E T +++PVR ASFH SAT AVT+++SK+ R Sbjct: 2 VVVMGDMSINLVLHHGTMLPHEHVTSLVKPVRQCASFHLVSATCAVTSTSSKAQR 56 >GAU19075.1 hypothetical protein TSUD_99370 [Trifolium subterraneum] Length = 296 Score = 58.2 bits (139), Expect = 2e-07 Identities = 32/52 (61%), Positives = 35/52 (67%) Frame = +1 Query: 226 MANRSINLAFHHGSMLPSEPATLVLRPVRLFASFHSFSATGAVTTSASKSLR 381 M N SINL FHHGSMLP E T ++RPVR+ ASFH S T AV S SK R Sbjct: 6 MGNSSINLVFHHGSMLPHEHVTSLVRPVRICASFHLNSVTWAV-KSTSKDQR 56