BLASTX nr result
ID: Glycyrrhiza28_contig00025027
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00025027 (296 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SFN71546.1 ATP-dependent Clp protease ATP-binding subunit ClpB [... 55 1e-06 >SFN71546.1 ATP-dependent Clp protease ATP-binding subunit ClpB [Bradyrhizobium sp. Ghvi] Length = 888 Score = 55.1 bits (131), Expect = 1e-06 Identities = 27/32 (84%), Positives = 31/32 (96%), Gaps = 1/32 (3%) Frame = -3 Query: 93 GRPREKR-MNIEKYTERARGFIQSAQSLAMRD 1 GRPRE++ MNIEKYTER+RGFIQSAQSLAMR+ Sbjct: 2 GRPRERKAMNIEKYTERSRGFIQSAQSLAMRE 33