BLASTX nr result
ID: Glycyrrhiza28_contig00024976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00024976 (390 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CCD94893.1 hypothetical protein BRAO375_3780008 [Bradyrhizobium ... 54 4e-07 SFJ35603.1 hypothetical protein SAMN05216525_12324 [Bradyrhizobi... 55 5e-07 >CCD94893.1 hypothetical protein BRAO375_3780008 [Bradyrhizobium sp. ORS 375] Length = 94 Score = 54.3 bits (129), Expect = 4e-07 Identities = 37/76 (48%), Positives = 44/76 (57%), Gaps = 4/76 (5%) Frame = +3 Query: 165 INLIGGPGRTRTCNQTVMSGRKRNAAVDFSAF---FVMFGRV-YRSWRDRFWCETGAAGL 332 + + GGPGRTRTCNQTVMSGR + VDF AF F F V + S+ R WC G Sbjct: 17 VEISGGPGRTRTCNQTVMSGRISISFVDFPAFSYDFKAFRIVSFTSFLVRNWC-----GY 71 Query: 333 ACDPDR*TAWLVGSTS 380 DP R +VGST+ Sbjct: 72 PIDPSR--RDIVGSTA 85 >SFJ35603.1 hypothetical protein SAMN05216525_12324 [Bradyrhizobium sp. Gha] Length = 186 Score = 55.1 bits (131), Expect(2) = 5e-07 Identities = 29/49 (59%), Positives = 33/49 (67%), Gaps = 4/49 (8%) Frame = +3 Query: 177 GGPGRTRTCNQTVMSGRKRNAAVDFSAFFVMFGRVYR----SWRDRFWC 311 GGPGRTRTCNQTVMSGR + VDF+AF + F V R S+ R WC Sbjct: 136 GGPGRTRTCNQTVMSGRLSTSLVDFAAFSLEFDCVRRGLFTSFLVRNWC 184 Score = 25.8 bits (55), Expect(2) = 5e-07 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 Query: 299 SFLVRNWCG 325 SFLVRNWCG Sbjct: 177 SFLVRNWCG 185