BLASTX nr result
ID: Glycyrrhiza28_contig00024939
seq
BLASTX 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Glycyrrhiza28_contig00024939
(295 letters)
Database: ./nr
115,041,592 sequences; 42,171,959,267 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
WP_003857318.1 MULTISPECIES: hypothetical protein [Bacteria] CBK... 130 8e-38
WP_058673638.1 hypothetical protein [Enterobacter hormaechei] KT... 129 2e-37
WP_045141535.1 MULTISPECIES: hypothetical protein [Enterobacter ... 129 2e-37
WP_023314096.1 MULTISPECIES: hypothetical protein [Enterobacter ... 128 5e-37
WP_022648035.1 MULTISPECIES: hypothetical protein [Enterobacteri... 122 7e-35
WP_063451411.1 hypothetical protein [Enterobacter cloacae comple... 121 3e-34
WP_065544949.1 hypothetical protein [Enterobacter cloacae] 120 3e-34
KJI79104.1 hypothetical protein UO82_13100 [Enterobacter cloacae] 120 7e-34
WP_006175081.1 hypothetical protein [Enterobacter cancerogenus] ... 119 1e-33
WP_006810544.1 hypothetical protein [Enterobacter hormaechei] EG... 119 2e-33
WP_058608860.1 hypothetical protein [Enterobacter cancerogenus] ... 118 3e-33
WP_059357030.1 hypothetical protein [Enterobacter cloacae comple... 117 1e-32
WP_047027381.1 hypothetical protein [Enterobacter kobei] KLG2533... 116 3e-32
WP_014883742.1 MULTISPECIES: hypothetical protein [Enterobacter]... 115 4e-32
WP_008502331.1 MULTISPECIES: hypothetical protein [Enterobacteri... 115 5e-32
AEW73520.1 hypothetical protein EcWSU1_02083 [Enterobacter cloac... 115 5e-32
WP_044596378.1 MULTISPECIES: hypothetical protein [Enterobacter ... 115 7e-32
WP_047633558.1 hypothetical protein [Enterobacter cloacae] KGY62... 115 7e-32
WP_059179008.1 hypothetical protein [Lelliottia amnigena] 114 1e-31
WP_041689413.1 hypothetical protein [Enterobacter sp. 638] 114 1e-31
>WP_003857318.1 MULTISPECIES: hypothetical protein [Bacteria] CBK85005.1
hypothetical protein ENC_11530 [Enterobacter cloacae
subsp. cloacae NCTC 9394] EIM36529.1 hypothetical
protein PGS1_03840 [Enterobacter cloacae subsp. cloacae
GS1] ERP07497.1 hypothetical protein L360_02203
[Enterobacter sp. MGH 14] ESL76276.1 hypothetical
protein L422_04146 [Enterobacter cloacae UCICRE 11]
ESM17057.1 hypothetical protein L416_02283 [Enterobacter
cloacae UCICRE 5] ESM80235.1 hypothetical protein
L384_03110 [Enterobacter sp. MGH 38] CDL33398.1
FIG00626483: hypothetical protein [Enterobacter cloacae
ISC8] EUM11119.1 hypothetical protein L464_04419
[Enterobacter sp. BIDMC 28] EUM17894.1 hypothetical
protein L463_02931 [Enterobacter sp. BIDMC 27]
EUM33960.1 hypothetical protein L435_05682 [Enterobacter
cloacae BIDMC 8] EUM39073.1 hypothetical protein
L406_04033 [Enterobacter sp. BWH 37] EUM52168.1
hypothetical protein L379_02345 [Enterobacter sp. MGH
33] EUM55781.1 hypothetical protein L361_01233
[Enterobacter sp. MGH 15] EUM77221.1 hypothetical
protein L356_07373 [Enterobacter sp. MGH 10] EUM81561.1
hypothetical protein L353_06972 [Enterobacter sp. MGH 7]
EUM88816.1 hypothetical protein L352_06533 [Enterobacter
sp. MGH 6] EUN07303.1 hypothetical protein L347_05960
[Enterobacter sp. MGH 1] EUN12517.1 hypothetical protein
L349_05013 [Enterobacter sp. MGH 3] KDF39557.1
hypothetical protein AE41_02189 [Enterobacter cloacae
BIDMC 66] KDF57079.1 hypothetical protein AF39_02245
[Enterobacter cloacae MGH 53] AIE63881.1 hypothetical
protein ECNIH2_10995 [Enterobacter cloacae ECNIH2]
KGY92211.1 hypothetical protein MC57_18780 [Enterobacter
cloacae] KGZ07293.1 hypothetical protein MC56_10335
[Enterobacter cloacae] KHC12271.1 hypothetical protein
KV26_32280 [Enterobacter hormaechei subsp. oharae]
KHG43911.1 hypothetical protein T636_A2216 [Enterobacter
hormaechei subsp. oharae] KHM07915.1 hypothetical
protein KV27_05140 [Enterobacter hormaechei subsp.
oharae] KHM09784.1 hypothetical protein KV32_03760
[Enterobacter hormaechei subsp. oharae] KHM10441.1
hypothetical protein KV24_02360 [Enterobacter hormaechei
subsp. oharae] KHM12187.1 hypothetical protein
KV31_20260 [Enterobacter hormaechei subsp.
steigerwaltii] KHM20124.1 hypothetical protein
KV28_03315 [Enterobacter hormaechei subsp. oharae]
KHM30870.1 hypothetical protein KV18_02395 [Enterobacter
hormaechei subsp. oharae] KHM31023.1 hypothetical
protein KV17_03140 [Enterobacter hormaechei subsp.
oharae] KHM41256.1 hypothetical protein KV21_08100
[Enterobacter hormaechei subsp. oharae] KHM42198.1
hypothetical protein KV16_04690 [Enterobacter hormaechei
subsp. oharae] KHM61596.1 hypothetical protein
KV29_0217010 [Enterobacter hormaechei subsp. oharae]
KHM65085.1 hypothetical protein KV23_0202180
[Enterobacter hormaechei subsp. oharae] KHM66707.1
hypothetical protein KV14_0210830 [Enterobacter
hormaechei subsp. oharae] KHM73913.1 hypothetical
protein KV33_0218795 [Enterobacter hormaechei subsp.
oharae] KHM80046.1 hypothetical protein KV25_0200910
[Enterobacter hormaechei subsp. oharae] KHM80789.1
hypothetical protein KV19_0216260 [Enterobacter
hormaechei subsp. oharae] KHM85485.1 hypothetical
protein KV15_0216875 [Enterobacter hormaechei subsp.
oharae] KHM89095.1 hypothetical protein KV20_0218785
[Enterobacter hormaechei subsp. oharae] KHQ17426.1
hypothetical protein KV22_10755 [Enterobacter hormaechei
subsp. oharae] KHQ58316.1 hypothetical protein
KV13_15040 [Enterobacter hormaechei subsp. oharae]
AJB62589.1 hypothetical protein LI62_11120 [Enterobacter
hormaechei subsp. steigerwaltii] AJB81736.1 hypothetical
protein LI66_10325 [Enterobacter hormaechei subsp.
oharae] KJC00625.1 hypothetical protein TN43_13725
[Enterobacter cloacae] KJF32735.1 hypothetical protein
L469_01765 [Enterobacter cloacae BIDMC 33A] KJH90606.1
hypothetical protein UO96_18565 [Enterobacter cloacae]
KJH92775.1 hypothetical protein UO80_13575 [Enterobacter
cloacae] KJI00451.1 hypothetical protein UO86_20475
[Enterobacter cloacae] KJI15685.1 hypothetical protein
UO87_15010 [Enterobacter cloacae] KJI22642.1
hypothetical protein UO90_11005 [Enterobacter cloacae]
KJI30993.1 hypothetical protein UO79_21495 [Enterobacter
cloacae] KJI32579.1 hypothetical protein UO84_00280
[Enterobacter cloacae] KJI39086.1 hypothetical protein
UO93_16115 [Enterobacter cloacae] KJI39131.1
hypothetical protein UO83_15355 [Enterobacter cloacae]
KJI46193.1 hypothetical protein UO81_21720 [Enterobacter
cloacae] KJI56561.1 hypothetical protein UO78_08735
[Enterobacter cloacae] KJI68268.1 hypothetical protein
UO91_20370 [Enterobacter cloacae] KJI71433.1
hypothetical protein UP04_20855 [Enterobacter cloacae]
KJI92107.1 hypothetical protein UO98_05395 [Enterobacter
cloacae] KJI92200.1 hypothetical protein UP05_10380
[Enterobacter cloacae] KJI99099.1 hypothetical protein
UO89_10090 [Enterobacter cloacae] KJJ01549.1
hypothetical protein UP02_15580 [Enterobacter cloacae]
KJJ01625.1 hypothetical protein UP03_18555 [Enterobacter
cloacae] KJL50117.1 hypothetical protein SS19_23010
[Enterobacter hormaechei subsp. steigerwaltii]
KJL60692.1 hypothetical protein SS57_06815 [Enterobacter
hormaechei subsp. oharae] KJL67927.1 hypothetical
protein SS62_05280 [Enterobacter hormaechei subsp.
oharae] KJL72249.1 hypothetical protein SS38_06560
[Enterobacter hormaechei subsp. oharae] KJL73407.1
hypothetical protein SS35_20160 [Enterobacter hormaechei
subsp. steigerwaltii] KJL85820.1 hypothetical protein
SS24_07745 [Enterobacter hormaechei subsp.
steigerwaltii] KJL91137.1 hypothetical protein
SS61_08625 [Enterobacter hormaechei subsp.
steigerwaltii] KJM02082.1 hypothetical protein
SS22_00505 [Enterobacter hormaechei subsp. oharae]
KJM19516.1 hypothetical protein SS34_18845 [Enterobacter
hormaechei subsp. oharae] KJM23131.1 hypothetical
protein SS26_10165 [Enterobacter hormaechei subsp.
oharae] KJM37217.1 hypothetical protein SS54_01275
[Enterobacter hormaechei subsp. oharae] KJM49942.1
hypothetical protein SS46_10445 [Enterobacter hormaechei
subsp. oharae] KJM57205.1 hypothetical protein
SS23_17405 [Enterobacter hormaechei subsp.
steigerwaltii] KJM67960.1 hypothetical protein
SS59_11570 [Enterobacter hormaechei subsp. oharae]
KJM72511.1 hypothetical protein SS28_15190 [Enterobacter
hormaechei subsp. steigerwaltii] KJM80336.1 hypothetical
protein SS16_02250 [Enterobacter hormaechei subsp.
oharae] KJM93557.1 hypothetical protein SS53_15395
[Enterobacter hormaechei subsp. steigerwaltii]
KJN07554.1 hypothetical protein SS42_03800 [Enterobacter
hormaechei subsp. oharae] KJN11859.1 hypothetical
protein SS29_04270 [Enterobacter hormaechei subsp.
steigerwaltii] KJN19761.1 hypothetical protein
SS18_15310 [Enterobacter hormaechei subsp.
steigerwaltii] KJN29539.1 hypothetical protein
SS41_07750 [Enterobacter hormaechei subsp. oharae]
KJN42539.1 hypothetical protein SS45_16700 [Enterobacter
hormaechei subsp. steigerwaltii] KJN46054.1 hypothetical
protein SS40_16475 [Enterobacter hormaechei subsp.
steigerwaltii] KJN61183.1 hypothetical protein
SS49_19445 [Enterobacter hormaechei subsp.
steigerwaltii] KJN62870.1 hypothetical protein
SS36_13435 [Enterobacter hormaechei subsp.
steigerwaltii] KJN78009.1 hypothetical protein
SS48_13135 [Enterobacter hormaechei subsp. oharae]
KJN80272.1 hypothetical protein SS09_08380 [Enterobacter
hormaechei subsp. oharae] KJN86570.1 hypothetical
protein SS07_13720 [Enterobacter hormaechei subsp.
oharae] KJO02926.1 hypothetical protein SR96_17260
[Enterobacter hormaechei subsp. oharae] KJO14419.1
hypothetical protein SS10_15380 [Enterobacter hormaechei
subsp. oharae] KJO14594.1 hypothetical protein
SR91_19315 [Enterobacter hormaechei subsp.
steigerwaltii] KJO31521.1 hypothetical protein
SS08_08395 [Enterobacter hormaechei subsp.
steigerwaltii] KJO34628.1 hypothetical protein
SS01_05615 [Enterobacter hormaechei subsp. oharae]
KJO52835.1 hypothetical protein SR88_21340 [Enterobacter
hormaechei subsp. steigerwaltii] KJO64808.1 hypothetical
protein SR99_14535 [Enterobacter hormaechei subsp.
steigerwaltii] KJO73649.1 hypothetical protein
SR90_10070 [Enterobacter hormaechei subsp. oharae]
KJO73801.1 hypothetical protein SR92_10210 [Enterobacter
hormaechei subsp. oharae] KJO90669.1 hypothetical
protein SR97_00465 [Enterobacter hormaechei subsp.
oharae] KJO90788.1 hypothetical protein SR86_05860
[Enterobacter hormaechei subsp. oharae] KJO91298.1
hypothetical protein SR84_23380 [Enterobacter hormaechei
subsp. oharae] KJO96714.1 hypothetical protein
SR93_03525 [Enterobacter hormaechei subsp. oharae]
KJP04315.1 hypothetical protein SR95_05680 [Enterobacter
hormaechei subsp. oharae] KJP08032.1 hypothetical
protein SS02_07090 [Enterobacter hormaechei subsp.
steigerwaltii] KJP22167.1 hypothetical protein
SR64_05715 [Enterobacter hormaechei subsp. oharae]
KJP29801.1 hypothetical protein SR77_03785 [Enterobacter
hormaechei subsp. oharae] KJP34444.1 hypothetical
protein SR80_08640 [Enterobacter hormaechei subsp.
oharae] KJP50896.1 hypothetical protein SR66_04010
[Enterobacter hormaechei subsp. oharae] KJP52351.1
hypothetical protein SR73_03405 [Enterobacter hormaechei
subsp. oharae] KJP54255.1 hypothetical protein
SR72_23055 [Enterobacter hormaechei subsp.
steigerwaltii] KJP66830.1 hypothetical protein
SR69_08740 [Enterobacter hormaechei subsp. oharae]
KJP73531.1 hypothetical protein SR68_01080 [Enterobacter
hormaechei subsp. oharae] KJP75579.1 hypothetical
protein SR76_06530 [Enterobacter hormaechei subsp.
steigerwaltii] KJP78788.1 hypothetical protein
SR75_10570 [Enterobacter hormaechei subsp. oharae]
KJP90714.1 hypothetical protein VE14_23115 [Enterobacter
cloacae] KJP99895.1 hypothetical protein VE16_12530
[Enterobacter cloacae] KJQ04257.1 hypothetical protein
VE12_22930 [Enterobacter cloacae] KJQ16422.1
hypothetical protein VE13_11380 [Enterobacter cloacae]
KJQ17931.1 hypothetical protein VE15_16960 [Enterobacter
cloacae] KJQ22332.1 hypothetical protein VE22_23715
[Enterobacter cloacae] KJQ25477.1 hypothetical protein
VE20_12425 [Enterobacter cloacae] KJQ33472.1
hypothetical protein VE17_01690 [Enterobacter cloacae]
KJQ41932.1 hypothetical protein VE19_18520 [Enterobacter
cloacae] KJW81387.1 hypothetical protein SG70_15035
[Enterobacter hormaechei subsp. steigerwaltii]
KJW81832.1 hypothetical protein SG68_16590 [Enterobacter
hormaechei subsp. steigerwaltii] KJW94592.1 hypothetical
protein SG65_04465 [Enterobacter hormaechei subsp.
steigerwaltii] KJX02403.1 hypothetical protein
SG69_14340 [Enterobacter hormaechei subsp.
steigerwaltii] KJX16773.1 hypothetical protein
SG64_17175 [Enterobacter hormaechei subsp. oharae]
KJX24465.1 hypothetical protein SG74_04725 [Enterobacter
hormaechei subsp. oharae] KJX27645.1 hypothetical
protein SG82_02455 [Enterobacter hormaechei subsp.
oharae] KJX29783.1 hypothetical protein SG76_18925
[Enterobacter hormaechei subsp. steigerwaltii]
KJX40152.1 hypothetical protein SG78_14570 [Enterobacter
hormaechei subsp. steigerwaltii] KJX46144.1 hypothetical
protein SG79_08665 [Enterobacter hormaechei subsp.
oharae] KJX49476.1 hypothetical protein SG73_15920
[Enterobacter hormaechei subsp. steigerwaltii]
KJX55848.1 hypothetical protein SG75_10800 [Enterobacter
hormaechei subsp. steigerwaltii] KJX60815.1 hypothetical
protein SG80_10570 [Enterobacter hormaechei subsp.
steigerwaltii] KJX63370.1 hypothetical protein
SG81_18590 [Enterobacter hormaechei subsp.
steigerwaltii] KKA35031.1 hypothetical protein
SG77_05585 [Enterobacter hormaechei subsp.
steigerwaltii] CQR77902.1 hypothetical protein
BN1385_02807 [Enterobacter cloacae] KLE19011.1
hypothetical protein AAV10_16560 [Enterobacter cloacae]
KLF82475.1 hypothetical protein YA41_22430 [Enterobacter
hormaechei subsp. steigerwaltii] KLF83098.1 hypothetical
protein YA43_08655 [Enterobacter hormaechei subsp.
steigerwaltii] KLF96217.1 hypothetical protein
YA42_04295 [Enterobacter hormaechei subsp.
steigerwaltii] KLF96400.1 hypothetical protein
YA45_15085 [Enterobacter hormaechei subsp.
steigerwaltii] KLF99419.1 hypothetical protein
YA46_22400 [Enterobacter hormaechei subsp. oharae]
AKK75358.1 hypothetical protein ABY62_01300
[Enterobacter cloacae] AKK92699.1 hypothetical protein
ABY65_15675 [Enterobacter cloacae] AKK96158.1
hypothetical protein ABY64_09315 [Enterobacter cloacae]
AKL51527.1 hypothetical protein AB285_09150
[Enterobacter cloacae] KLP64781.1 hypothetical protein
ABF82_09750 [Enterobacter hormaechei subsp.
steigerwaltii] KLP71452.1 hypothetical protein
ABF80_22125 [Enterobacter hormaechei subsp.
steigerwaltii] KLP74343.1 hypothetical protein
ABF81_13260 [Enterobacter hormaechei subsp.
steigerwaltii] KLP87118.1 hypothetical protein
ABF79_07585 [Enterobacter hormaechei subsp.
steigerwaltii] KLQ01317.1 hypothetical protein
ABF76_15920 [Enterobacter hormaechei subsp. oharae]
KLQ01511.1 hypothetical protein ABF75_14315
[Enterobacter hormaechei subsp. oharae] KLQ20590.1
hypothetical protein ABF72_16735 [Enterobacter
hormaechei subsp. steigerwaltii] KLQ42998.1 hypothetical
protein ABF71_01850 [Enterobacter hormaechei subsp.
steigerwaltii] KLQ47938.1 hypothetical protein
ABF70_16870 [Enterobacter hormaechei subsp.
steigerwaltii] KLQ49225.1 hypothetical protein
ABF68_12810 [Enterobacter hormaechei subsp.
steigerwaltii] KLQ67713.1 hypothetical protein
ABF65_19100 [Enterobacter hormaechei subsp.
steigerwaltii] KLQ78237.1 hypothetical protein
ABF63_17300 [Enterobacter hormaechei subsp.
steigerwaltii] KLQ78886.1 hypothetical protein
ABF64_04385 [Enterobacter hormaechei subsp.
steigerwaltii] KLQ84329.1 hypothetical protein
ABF62_15910 [Enterobacter hormaechei subsp.
steigerwaltii] KLQ94548.1 hypothetical protein
ABF61_18075 [Enterobacter hormaechei subsp.
steigerwaltii] KLQ95738.1 hypothetical protein
ABF60_25215 [Enterobacter hormaechei subsp.
steigerwaltii] KLR03496.1 hypothetical protein
ABF59_21985 [Enterobacter hormaechei subsp.
steigerwaltii] KLR07385.1 hypothetical protein
ABF58_20095 [Enterobacter hormaechei subsp.
steigerwaltii] KLR38316.1 hypothetical protein
ABF57_02335 [Enterobacter hormaechei subsp.
steigerwaltii] KLR38677.1 hypothetical protein
ABF56_18030 [Enterobacter hormaechei subsp.
steigerwaltii] KLR66000.1 hypothetical protein
ABD04_09580 [Enterobacter cloacae] KLR68516.1
hypothetical protein ABD03_17910 [Enterobacter cloacae]
KLW07096.1 hypothetical protein SK45_02184 [Enterobacter
cloacae] KLW12835.1 hypothetical protein SK46_01236
[Enterobacter cloacae] KLW16661.1 hypothetical protein
SK47_01956 [Enterobacter sp. BWH52] KLW24116.1
hypothetical protein SK50_02603 [Enterobacter sp. BWH64]
KLW27116.1 hypothetical protein SK49_01187 [Enterobacter
sp. BWH63] KLW39852.1 hypothetical protein SK53_01015
[Enterobacter sp. MGH119] KLW42881.1 hypothetical
protein SK54_02681 [Enterobacter sp. MGH120] KLW47599.1
hypothetical protein SK52_02370 [Enterobacter sp. MGH86]
KLW56633.1 hypothetical protein SK56_01238 [Enterobacter
sp. MGH128] KLW62001.1 hypothetical protein SK58_02709
[Enterobacter sp. BIDMC93] KLW68582.1 hypothetical
protein SK57_01222 [Enterobacter sp. BIDMC87] KLW69499.1
hypothetical protein SK60_02088 [Enterobacter sp.
BIDMC99] KLW71437.1 hypothetical protein SK59_04044
[Enterobacter sp. BIDMC94] KLW83321.1 hypothetical
protein SK62_02160 [Enterobacter sp. BIDMC109]
KLW85235.1 hypothetical protein SK61_01923 [Enterobacter
sp. BIDMC100] KLW94849.1 hypothetical protein SK63_00340
[Enterobacter sp. BIDMC110] AKZ84239.1 hypothetical
protein LI65_011670 [Enterobacter hormaechei subsp.
steigerwaltii] ALA02133.1 hypothetical protein
LI63_012660 [Enterobacter hormaechei subsp. oharae]
KOQ81289.1 hypothetical protein ABW46_14390
[Enterobacter cloacae subsp. cloacae] KOQ89962.1
hypothetical protein ABW47_03785 [Enterobacter cloacae
subsp. cloacae] KPR16952.1 hypothetical protein
AN666_19380 [Enterobacter cloacae subsp. cloacae]
KRT37419.1 hypothetical protein AOX65_09450 [Escherichia
coli] KSZ04802.1 hypothetical protein APU17_09115
[Enterobacter sp. 50858885] KTG83776.1 hypothetical
protein ASV36_18010 [Enterobacter hormaechei subsp.
steigerwaltii] KTG87835.1 hypothetical protein
ASV38_06640 [Enterobacter hormaechei subsp. oharae]
KTG92448.1 hypothetical protein ASV35_24280
[Enterobacter hormaechei subsp. steigerwaltii]
KTG93610.1 hypothetical protein ASV34_15755
[Enterobacter hormaechei subsp. oharae] KTG96383.1
hypothetical protein ASV37_15625 [Enterobacter
hormaechei subsp. steigerwaltii] KTG98662.1 hypothetical
protein ASV33_15720 [Enterobacter hormaechei subsp.
oharae] KTH03708.1 hypothetical protein ASV32_15520
[Enterobacter hormaechei subsp. oharae] KTH29488.1
hypothetical protein ASV30_00215 [Enterobacter
hormaechei subsp. oharae] KTH42221.1 hypothetical
protein ASV27_18070 [Enterobacter hormaechei subsp.
steigerwaltii] KTH47299.1 hypothetical protein
ASV23_17925 [Enterobacter hormaechei subsp.
steigerwaltii] KTH53495.1 hypothetical protein
ASV22_12600 [Enterobacter hormaechei subsp. oharae]
KTH56601.1 hypothetical protein ASV24_00275
[Enterobacter hormaechei subsp. oharae] KTH64607.1
hypothetical protein ASV21_20380 [Enterobacter
hormaechei subsp. steigerwaltii] KTH83304.1 hypothetical
protein ASV17_17535 [Enterobacter hormaechei subsp.
oharae] KTH91073.1 hypothetical protein ASV15_09660
[Enterobacter hormaechei subsp. steigerwaltii]
KTH98019.1 hypothetical protein ASV12_05140
[Enterobacter hormaechei subsp. oharae] KTI03721.1
hypothetical protein ASV11_10395 [Enterobacter
hormaechei subsp. oharae] KTI05411.1 hypothetical
protein ASV13_09905 [Enterobacter hormaechei subsp.
steigerwaltii] KTI12768.1 hypothetical protein
ASV10_12540 [Enterobacter hormaechei subsp. oharae]
KTI34447.1 hypothetical protein ASV05_14750
[Enterobacter hormaechei subsp. oharae] KTI42660.1
hypothetical protein ASV04_06165 [Enterobacter
hormaechei subsp. oharae] KTI43173.1 hypothetical
protein ASV06_07645 [Enterobacter hormaechei subsp.
oharae] KTI45282.1 hypothetical protein ASV03_15090
[Enterobacter hormaechei subsp. steigerwaltii]
KTI52994.1 hypothetical protein ASV02_15535
[Enterobacter hormaechei subsp. oharae] KTI72316.1
hypothetical protein ASU99_00515 [Enterobacter
hormaechei subsp. steigerwaltii] KTI76962.1 hypothetical
protein ASU96_06845 [Enterobacter hormaechei subsp.
oharae] KTI83306.1 hypothetical protein ASU97_17800
[Enterobacter hormaechei subsp. steigerwaltii]
KTI86196.1 hypothetical protein ASU98_00295
[Enterobacter hormaechei subsp. steigerwaltii]
KTI87787.1 hypothetical protein ASU94_14375
[Enterobacter hormaechei subsp. oharae] KTJ00319.1
hypothetical protein ASU93_01730 [Enterobacter
hormaechei subsp. steigerwaltii] KTJ11101.1 hypothetical
protein ASU89_18195 [Enterobacter hormaechei subsp.
steigerwaltii] KTJ14139.1 hypothetical protein
ASU91_00615 [Enterobacter hormaechei subsp.
steigerwaltii] KTJ17042.1 hypothetical protein
ASU90_20200 [Enterobacter hormaechei subsp. oharae]
KTJ23582.1 hypothetical protein ASU86_09675
[Enterobacter hormaechei subsp. steigerwaltii]
KTJ31787.1 hypothetical protein ASU88_00200
[Enterobacter hormaechei subsp. oharae] KTJ41483.1
hypothetical protein ASU83_12210 [Enterobacter
hormaechei subsp. oharae] KTJ42986.1 hypothetical
protein ASU84_03960 [Enterobacter hormaechei subsp.
oharae] KTJ44344.1 hypothetical protein ASU82_11515
[Enterobacter hormaechei subsp. oharae] KTJ55226.1
hypothetical protein ASU80_10440 [Enterobacter
hormaechei subsp. oharae] KTJ59767.1 hypothetical
protein ASU81_18980 [Enterobacter hormaechei subsp.
steigerwaltii] KTJ68479.1 hypothetical protein
ASU77_08775 [Enterobacter hormaechei subsp.
steigerwaltii] KTJ83775.1 hypothetical protein
ASU75_10740 [Enterobacter hormaechei subsp.
steigerwaltii] KTJ89470.1 hypothetical protein
ASU73_04100 [Enterobacter hormaechei subsp. oharae]
KTJ93388.1 hypothetical protein ASU74_00270
[Enterobacter hormaechei subsp. oharae] KTK03223.1
hypothetical protein ASU69_11770 [Enterobacter
hormaechei subsp. steigerwaltii] KTK08339.1 hypothetical
protein ASU68_12600 [Enterobacter hormaechei subsp.
steigerwaltii] KTK15988.1 hypothetical protein
ASU66_14000 [Enterobacter hormaechei subsp. oharae]
KTK34945.1 hypothetical protein ASU65_00265
[Enterobacter hormaechei subsp. oharae] KTK39626.1
hypothetical protein ASU63_09950 [Enterobacter
hormaechei subsp. oharae] KTQ54072.1 hypothetical
protein NS23R_18930 [Enterobacter asburiae] KTQ56154.1
hypothetical protein NS34R_21030 [Enterobacter asburiae]
KTQ58164.1 hypothetical protein NS28R_17480
[Enterobacter xiangfangensis] KTQ67085.1 hypothetical
protein NS19R_21710 [Enterobacter xiangfangensis]
KTQ75999.1 hypothetical protein NS7_21800 [Enterobacter
asburiae] KTQ86601.1 hypothetical protein NS57R_19160
[Enterobacter xiangfangensis] KTQ91117.1 hypothetical
protein NS371_08490 [Enterobacter xiangfangensis]
KTR01381.1 hypothetical protein NS75R_04260
[Enterobacter xiangfangensis] KTR10050.1 hypothetical
protein NS49R_19005 [Enterobacter xiangfangensis]
KTR17499.1 hypothetical protein NS80R_06845
[Enterobacter xiangfangensis] KTR24132.1 hypothetical
protein NS64R_01605 [Enterobacter xiangfangensis]
KTR31787.1 hypothetical protein NS29R_18630
[Enterobacter xiangfangensis] KTR32521.1 hypothetical
protein NS24R_06025 [Enterobacter xiangfangensis]
KTR43333.1 hypothetical protein RSA8_12870 [Enterobacter
xiangfangensis] KUH54235.1 hypothetical protein
APR64_00920 [Enterobacter cloacae subsp. cloacae]
KUQ09955.1 hypothetical protein AWI06_12340
[Enterobacter hormaechei subsp. oharae] KUQ33996.1
hypothetical protein AWI11_21415 [Enterobacter
hormaechei subsp. steigerwaltii] KUQ35774.1 hypothetical
protein AWI15_03845 [Enterobacter hormaechei subsp.
oharae] KUQ59758.1 hypothetical protein AWI19_08780
[Enterobacter hormaechei subsp. oharae] KUQ67166.1
hypothetical protein AWI24_17835 [Enterobacter
hormaechei subsp. steigerwaltii] KUQ76115.1 hypothetical
protein AWI25_08700 [Enterobacter hormaechei subsp.
steigerwaltii] KUQ81177.1 hypothetical protein
AWI27_18730 [Enterobacter hormaechei subsp.
steigerwaltii] KUQ90596.1 hypothetical protein
AWI30_17305 [Enterobacter hormaechei subsp.
steigerwaltii] KUQ94679.1 hypothetical protein
AWI31_19820 [Enterobacter hormaechei subsp. oharae]
KUR25257.1 hypothetical protein AWI36_08380
[Enterobacter hormaechei subsp. steigerwaltii]
KVI51140.1 hypothetical protein AWS50_15710
[Enterobacter hormaechei subsp. steigerwaltii]
KVI59977.1 hypothetical protein AWS51_24695
[Enterobacter hormaechei subsp. steigerwaltii]
KVI64614.1 hypothetical protein AWS48_01965
[Enterobacter hormaechei subsp. oharae] KVI68194.1
hypothetical protein AWS49_18710 [Enterobacter
hormaechei subsp. steigerwaltii] KVI83143.1 hypothetical
protein AWS45_06500 [Enterobacter hormaechei subsp.
oharae] KVI90155.1 hypothetical protein AWS44_00280
[Enterobacter hormaechei subsp. oharae] KVI90542.1
hypothetical protein AWS43_00810 [Enterobacter
hormaechei subsp. steigerwaltii] KVJ03188.1 hypothetical
protein AWS41_15835 [Enterobacter hormaechei subsp.
oharae] KVJ09002.1 hypothetical protein AWS39_15775
[Enterobacter hormaechei subsp. oharae] KVJ15598.1
hypothetical protein AWS38_12935 [Enterobacter
hormaechei subsp. oharae] KVJ21300.1 hypothetical
protein AWS37_10465 [Enterobacter hormaechei subsp.
oharae] KVJ27925.1 hypothetical protein AWS36_21210
[Enterobacter hormaechei subsp. oharae] KVJ30376.1
hypothetical protein AWS34_06615 [Enterobacter
hormaechei subsp. steigerwaltii] KVJ31180.1 hypothetical
protein AWS35_00315 [Enterobacter hormaechei subsp.
oharae] KVJ45314.1 hypothetical protein AWS32_01110
[Enterobacter hormaechei subsp. oharae] KVJ47043.1
hypothetical protein AWS30_02790 [Enterobacter
hormaechei subsp. oharae] KVJ58050.1 hypothetical
protein AWS31_06060 [Enterobacter hormaechei subsp.
steigerwaltii] KVJ67009.1 hypothetical protein
AWS28_05600 [Enterobacter hormaechei subsp.
steigerwaltii] KVJ69898.1 hypothetical protein
AWS29_19495 [Enterobacter hormaechei subsp.
steigerwaltii] KVJ71270.1 hypothetical protein
AWS26_03910 [Enterobacter hormaechei subsp.
steigerwaltii] KVJ74673.1 hypothetical protein
AWS27_04930 [Enterobacter hormaechei subsp.
steigerwaltii] KVJ85311.1 hypothetical protein
AWS25_03640 [Enterobacter hormaechei subsp. oharae]
KVJ96029.1 hypothetical protein AWS20_09410
[Enterobacter hormaechei subsp. oharae] KVJ99343.1
hypothetical protein AWS22_16560 [Enterobacter
hormaechei subsp. steigerwaltii] KVK02554.1 hypothetical
protein AWS21_15670 [Enterobacter hormaechei subsp.
steigerwaltii] KVK07457.1 hypothetical protein
AWS18_10575 [Enterobacter hormaechei subsp.
steigerwaltii] KVK08789.1 hypothetical protein
AWS19_05815 [Enterobacter hormaechei subsp.
steigerwaltii] KVK23838.1 hypothetical protein
AWS16_18230 [Enterobacter hormaechei subsp.
steigerwaltii] KVK26234.1 hypothetical protein
AWS17_06280 [Enterobacter hormaechei subsp.
steigerwaltii] KVK29629.1 hypothetical protein
AWS15_08780 [Enterobacter hormaechei subsp.
steigerwaltii] KYH18563.1 hypothetical protein
A0133_16280 [Enterobacter cloacae] KYJ77769.1
hypothetical protein AT292_23715 [Enterobacter cloacae]
KYO10296.1 hypothetical protein ABF67_0207880
[Enterobacter ludwigii] CZW78400.1 Uncharacterised
protein [Enterobacter cloacae] CZY49086.1
Uncharacterised protein [Enterobacter cloacae]
CZX63152.1 Uncharacterised protein [Enterobacter
cloacae] CZV81583.1 Uncharacterised protein
[Enterobacter cloacae] CZX78399.1 Uncharacterised
protein [Enterobacter cloacae] CZZ26323.1
Uncharacterised protein [Enterobacter cloacae]
CZX27691.1 Uncharacterised protein [Enterobacter
cloacae] CZW55066.1 Uncharacterised protein
[Enterobacter cloacae] CZZ17877.1 Uncharacterised
protein [Enterobacter cloacae] CZX59250.1
Uncharacterised protein [Enterobacter cloacae]
CZZ08553.1 Uncharacterised protein [Enterobacter
cloacae] CZX93297.1 Uncharacterised protein
[Enterobacter cloacae] CZX71804.1 Uncharacterised
protein [Enterobacter cloacae] CZU37283.1
Uncharacterised protein [Enterobacter cloacae]
CZW90524.1 Uncharacterised protein [Enterobacter
cloacae] CZX58595.1 Uncharacterised protein
[Enterobacter cloacae] CZV06925.1 Uncharacterised
protein [Enterobacter cloacae] CZU88608.1
Uncharacterised protein [Enterobacter cloacae]
CZV13212.1 Uncharacterised protein [Enterobacter
cloacae] CZU38578.1 Uncharacterised protein
[Enterobacter cloacae] CZX89319.1 Uncharacterised
protein [Enterobacter cloacae] CZU45686.1
Uncharacterised protein [Enterobacter cloacae]
CZU35009.1 Uncharacterised protein [Enterobacter
cloacae] CZY12848.1 Uncharacterised protein
[Enterobacter cloacae] CZV44713.1 Uncharacterised
protein [Enterobacter cloacae] CZV00573.1
Uncharacterised protein [Enterobacter cloacae]
CZX24411.1 Uncharacterised protein [Enterobacter
cloacae] CZU63139.1 Uncharacterised protein
[Enterobacter cloacae] CZV82859.1 Uncharacterised
protein [Enterobacter cloacae] CZU36817.1
Uncharacterised protein [Enterobacter cloacae]
CZU81936.1 Uncharacterised protein [Enterobacter
cloacae] CZW79473.1 Uncharacterised protein
[Enterobacter cloacae] CZW54201.1 Uncharacterised
protein [Enterobacter cloacae] CZY84026.1
Uncharacterised protein [Enterobacter cloacae]
CZU49854.1 Uncharacterised protein [Enterobacter
cloacae] CZV85838.1 Uncharacterised protein
[Enterobacter cloacae] CZY17633.1 Uncharacterised
protein [Enterobacter cloacae] CZV98180.1
Uncharacterised protein [Enterobacter cloacae]
CZU81302.1 Uncharacterised protein [Enterobacter
cloacae] CZX09571.1 Uncharacterised protein
[Enterobacter cloacae] CZV47072.1 Uncharacterised
protein [Enterobacter cloacae] CZW03582.1
Uncharacterised protein [Enterobacter cloacae]
CZV69410.1 Uncharacterised protein [Enterobacter
cloacae] CZX55673.1 Uncharacterised protein
[Enterobacter cloacae] CZX10939.1 Uncharacterised
protein [Enterobacter cloacae] CZY21667.1
Uncharacterised protein [Enterobacter cloacae]
CZX35225.1 Uncharacterised protein [Enterobacter
cloacae] CZX55183.1 Uncharacterised protein
[Enterobacter cloacae] CZV16375.1 Uncharacterised
protein [Enterobacter cloacae] CZU51033.1
Uncharacterised protein [Enterobacter cloacae]
CZV30330.1 Uncharacterised protein [Enterobacter
cloacae] CZU49184.1 Uncharacterised protein
[Enterobacter cloacae] CZU50029.1 Uncharacterised
protein [Enterobacter cloacae] CZY23222.1
Uncharacterised protein [Enterobacter cloacae]
CZY49502.1 Uncharacterised protein [Enterobacter
cloacae] CZW59228.1 Uncharacterised protein
[Enterobacter cloacae] CZY84064.1 Uncharacterised
protein [Enterobacter cloacae] CZW01886.1
Uncharacterised protein [Enterobacter cloacae]
CZW26344.1 Uncharacterised protein [Enterobacter
cloacae] CZV48295.1 Uncharacterised protein
[Enterobacter cloacae] CZU34379.1 Uncharacterised
protein [Enterobacter cloacae] CZU19134.1
Uncharacterised protein [Enterobacter cloacae]
CZU72658.1 Uncharacterised protein [Enterobacter
cloacae] CZV04254.1 Uncharacterised protein
[Enterobacter cloacae] CZU61538.1 Uncharacterised
protein [Enterobacter cloacae] CZU41896.1
Uncharacterised protein [Enterobacter cloacae]
CZW53186.1 Uncharacterised protein [Enterobacter
cloacae] CZW31303.1 Uncharacterised protein
[Enterobacter cloacae] CZX84371.1 Uncharacterised
protein [Enterobacter cloacae] SAE40399.1
Uncharacterised protein [Enterobacter cloacae]
SAE28174.1 Uncharacterised protein [Enterobacter
cloacae] SAG49773.1 Uncharacterised protein
[Enterobacter cloacae] SAH58285.1 Uncharacterised
protein [Enterobacter cloacae] SAH78695.1
Uncharacterised protein [Enterobacter cloacae]
SAC96013.1 Uncharacterised protein [Enterobacter
cloacae] CZY60444.1 Uncharacterised protein
[Enterobacter cloacae] SAH38780.1 Uncharacterised
protein [Enterobacter cloacae] SAF97924.1
Uncharacterised protein [Enterobacter cloacae]
SAG87596.1 Uncharacterised protein [Enterobacter
cloacae] CZZ84215.1 Uncharacterised protein
[Enterobacter cloacae] SAG98119.1 Uncharacterised
protein [Enterobacter cloacae] SAC87395.1
Uncharacterised protein [Enterobacter cloacae]
SAH84508.1 Uncharacterised protein [Enterobacter
cloacae] SAC60005.1 Uncharacterised protein
[Enterobacter cloacae] SAC01529.1 Uncharacterised
protein [[Enterobacter] aerogenes] SAD68712.1
Uncharacterised protein [Enterobacter cloacae]
SAD13356.1 Uncharacterised protein [Enterobacter
cloacae] SAA30669.1 Uncharacterised protein
[Enterobacter cloacae] SAC03692.1 Uncharacterised
protein [Enterobacter cloacae] SAF70789.1
Uncharacterised protein [Enterobacter cloacae]
SAC69869.1 Uncharacterised protein [Enterobacter
cloacae] SAB81757.1 Uncharacterised protein
[Enterobacter cloacae] SAE57183.1 Uncharacterised
protein [Enterobacter cloacae] SAB50994.1
Uncharacterised protein [Enterobacter cloacae]
SAG46376.1 Uncharacterised protein [Enterobacter
cloacae] SAC75012.1 Uncharacterised protein
[Enterobacter cloacae] SAF95322.1 Uncharacterised
protein [Enterobacter cloacae] SAA48336.1
Uncharacterised protein [Enterobacter cloacae]
SAE05946.1 Uncharacterised protein [Enterobacter
cloacae] SAI21414.1 Uncharacterised protein
[Enterobacter cloacae] SAF04989.1 Uncharacterised
protein [Enterobacter cloacae] SAC60270.1
Uncharacterised protein [Enterobacter cloacae]
SAI39981.1 Uncharacterised protein [Enterobacter
cloacae] SAD73952.1 Uncharacterised protein
[Enterobacter cloacae] SAC22086.1 Uncharacterised
protein [Enterobacter cloacae] SAD26141.1
Uncharacterised protein [Enterobacter cloacae]
SAE33355.1 Uncharacterised protein [Enterobacter
cloacae] SAE97110.1 Uncharacterised protein
[Enterobacter cloacae] SAC99132.1 Uncharacterised
protein [Enterobacter cloacae] SAH71175.1
Uncharacterised protein [Enterobacter cloacae]
SAC91180.1 Uncharacterised protein [Enterobacter
cloacae] SAD59118.1 Uncharacterised protein
[Enterobacter cloacae] SAF62120.1 Uncharacterised
protein [Enterobacter cloacae] SAD17380.1
Uncharacterised protein [Enterobacter cloacae]
SAA52893.1 Uncharacterised protein [Enterobacter
cloacae] SAH35752.1 Uncharacterised protein
[Enterobacter cloacae] SAA08411.1 Uncharacterised
protein [Enterobacter cloacae] SAB60933.1
Uncharacterised protein [Enterobacter cloacae]
CZZ70289.1 Uncharacterised protein [Enterobacter
cloacae] SAA03358.1 Uncharacterised protein
[Enterobacter cloacae] SAE91110.1 Uncharacterised
protein [Enterobacter cloacae] SAI38072.1
Uncharacterised protein [Enterobacter cloacae]
CZZ49406.1 Uncharacterised protein [Enterobacter
cloacae] SAD04571.1 Uncharacterised protein
[Enterobacter cloacae] SAA55057.1 Uncharacterised
protein [Enterobacter cloacae] SAF27262.1
Uncharacterised protein [Enterobacter cloacae]
SAA53103.1 Uncharacterised protein [Enterobacter
cloacae] SAE98421.1 Uncharacterised protein
[Enterobacter cloacae] SAC15578.1 Uncharacterised
protein [Enterobacter cloacae] SAA25733.1
Uncharacterised protein [Enterobacter cloacae]
CZY90470.1 Uncharacterised protein [Enterobacter
cloacae] SAH50763.1 Uncharacterised protein
[Enterobacter cloacae] SAD60560.1 Uncharacterised
protein [Enterobacter cloacae] SAD96310.1
Uncharacterised protein [Enterobacter cloacae]
SAF25764.1 Uncharacterised protein [Enterobacter
cloacae] SAF64501.1 Uncharacterised protein
[Enterobacter cloacae] SAA59875.1 Uncharacterised
protein [Enterobacter cloacae] SAC00492.1
Uncharacterised protein [Enterobacter cloacae]
CZZ18790.1 Uncharacterised protein [Enterobacter
cloacae] SAB38265.1 Uncharacterised protein
[Enterobacter cloacae] SAB37353.1 Uncharacterised
protein [Enterobacter cloacae] SAF05638.1
Uncharacterised protein [Enterobacter cloacae]
SAH24666.1 Uncharacterised protein [Enterobacter
cloacae] SAA97372.1 Uncharacterised protein
[Enterobacter cloacae] SAA18076.1 Uncharacterised
protein [Enterobacter cloacae] SAC62337.1
Uncharacterised protein [Enterobacter cloacae]
SAD29244.1 Uncharacterised protein [Enterobacter
cloacae] CZZ26161.1 Uncharacterised protein
[Enterobacter cloacae] SAB18729.1 Uncharacterised
protein [Enterobacter cloacae] CZZ59048.1
Uncharacterised protein [Enterobacter cloacae]
CZZ68185.1 Uncharacterised protein [Enterobacter
cloacae] SAB42849.1 Uncharacterised protein
[Enterobacter cloacae] SAG05663.1 Uncharacterised
protein [Enterobacter cloacae] CZZ61550.1
Uncharacterised protein [Enterobacter cloacae]
SAG68337.1 Uncharacterised protein [Enterobacter
cloacae] SAB70839.1 Uncharacterised protein
[Enterobacter cloacae] SAD68658.1 Uncharacterised
protein [Enterobacter cloacae] SAB04518.1
Uncharacterised protein [Enterobacter cloacae]
CZZ32536.1 Uncharacterised protein [Enterobacter
cloacae] SAF75813.1 Uncharacterised protein
[Enterobacter cloacae] SAB11419.1 Uncharacterised
protein [Enterobacter cloacae] SAG07689.1
Uncharacterised protein [Enterobacter cloacae]
SAG41835.1 Uncharacterised protein [Enterobacter
cloacae] SAF72276.1 Uncharacterised protein
[Enterobacter cloacae] SAA90194.1 Uncharacterised
protein [Enterobacter cloacae] CZZ02021.1
Uncharacterised protein [Enterobacter cloacae]
SAD31602.1 Uncharacterised protein [Enterobacter
cloacae] SAH53841.1 Uncharacterised protein
[Enterobacter cloacae] SAA30967.1 Uncharacterised
protein [Enterobacter cloacae] SAI29348.1
Uncharacterised protein [Enterobacter cloacae]
SAG73857.1 Uncharacterised protein [Enterobacter
cloacae] CZY98287.1 Uncharacterised protein
[Enterobacter cloacae] SAH16580.1 Uncharacterised
protein [Enterobacter cloacae] SAE03392.1
Uncharacterised protein [Enterobacter cloacae]
SAG01696.1 Uncharacterised protein [Enterobacter
cloacae] CZZ36804.1 Uncharacterised protein
[Enterobacter cloacae] SAF27526.1 Uncharacterised
protein [Enterobacter cloacae] SAG69247.1
Uncharacterised protein [Enterobacter cloacae]
CZZ00511.1 Uncharacterised protein [Enterobacter
cloacae] SAE10419.1 Uncharacterised protein
[Enterobacter cloacae] SAD89994.1 Uncharacterised
protein [Enterobacter cloacae] SAH02216.1
Uncharacterised protein [Enterobacter cloacae]
CZY91810.1 Uncharacterised protein [Enterobacter
cloacae] CZY87327.1 Uncharacterised protein
[Enterobacter cloacae] SAE41841.1 Uncharacterised
protein [Enterobacter cloacae] SAF83703.1
Uncharacterised protein [Enterobacter cloacae]
SAE29871.1 Uncharacterised protein [Enterobacter
cloacae] SAC82561.1 Uncharacterised protein
[Enterobacter cloacae] SAF82796.1 Uncharacterised
protein [Enterobacter cloacae] SAE02806.1
Uncharacterised protein [Enterobacter cloacae]
SAG20422.1 Uncharacterised protein [Enterobacter
cloacae] SAG96719.1 Uncharacterised protein
[Enterobacter cloacae] SAG27496.1 Uncharacterised
protein [Enterobacter cloacae] SAF83402.1
Uncharacterised protein [Enterobacter cloacae]
SAI99409.1 Uncharacterised protein [Enterobacter
cloacae] SAI91937.1 Uncharacterised protein
[Enterobacter cloacae] SAI91362.1 Uncharacterised
protein [Enterobacter cloacae] SAJ19073.1
Uncharacterised protein [Enterobacter cloacae]
KZP52369.1 hypothetical protein A3N34_09065
[Enterobacter hormaechei subsp. steigerwaltii]
KZP55063.1 hypothetical protein A3N38_06765
[Enterobacter hormaechei subsp. steigerwaltii]
KZP70904.1 hypothetical protein A3N36_13270
[Enterobacter hormaechei subsp. oharae] KZP81747.1
hypothetical protein A3N41_03850 [Enterobacter
hormaechei subsp. steigerwaltii] KZP84348.1 hypothetical
protein A3N47_10600 [Enterobacter hormaechei subsp.
oharae] KZP89147.1 hypothetical protein A3N35_03750
[Enterobacter hormaechei subsp. steigerwaltii]
KZQ17988.1 hypothetical protein A3N39_10205
[Enterobacter hormaechei subsp. steigerwaltii]
KZQ20628.1 hypothetical protein A3N48_08990
[Enterobacter hormaechei subsp. steigerwaltii]
KZQ33599.1 hypothetical protein A3N44_03625
[Enterobacter hormaechei subsp. steigerwaltii]
KZQ46891.1 hypothetical protein A3N49_04545
[Enterobacter hormaechei subsp. steigerwaltii]
KZQ84715.1 hypothetical protein A3N64_16315
[Enterobacter hormaechei subsp. steigerwaltii]
KZQ90525.1 hypothetical protein A3N55_11075
[Enterobacter hormaechei subsp. steigerwaltii]
KZQ96905.1 hypothetical protein A3N66_01725
[Enterobacter hormaechei subsp. steigerwaltii]
KZR01496.1 hypothetical protein A3N59_03645
[Enterobacter hormaechei subsp. steigerwaltii]
KZR22651.1 hypothetical protein A3N53_04700
[Enterobacter hormaechei subsp. steigerwaltii]
OAH36109.1 hypothetical protein AYJ11_09935
[Enterobacter xiangfangensis] SAP46824.1 Uncharacterised
protein [Klebsiella oxytoca] OAR76151.1 hypothetical
protein AYO00_21770 [Enterobacter cloacae] OAR88775.1
hypothetical protein AYO01_14725 [Enterobacter cloacae]
ANS17822.1 hypothetical protein AB284_14675
[Enterobacter hormaechei] AOP78014.1 hypothetical
protein BFV68_10340 [Enterobacter hormaechei subsp.
steigerwaltii] AOP83345.1 hypothetical protein
BFV66_15400 [Enterobacter hormaechei subsp. oharae]
AOP91312.1 hypothetical protein BFV63_10510
[Enterobacter xiangfangensis] OEH19291.1 hypothetical
protein AN659_0214260 [Enterobacter sp. ST121:950178628]
SCZ21590.1 hypothetical protein SAMN03159368_0623
[Enterobacter sp. NFIX45] APR41715.1 hypothetical
protein AM329_06545 [Enterobacter cloacae] OOK63327.1
hypothetical protein GY25_17735 [Pedobacter
himalayensis]
Length = 65
Score = 130 bits (326), Expect = 8e-38
Identities = 65/65 (100%), Positives = 65/65 (100%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN
Sbjct: 1 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_058673638.1 hypothetical protein [Enterobacter hormaechei] KTH46508.1
hypothetical protein ASV25_18505 [Enterobacter
hormaechei subsp. oharae]
Length = 65
Score = 129 bits (323), Expect = 2e-37
Identities = 64/65 (98%), Positives = 65/65 (100%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MKHLLMTLFSSPESLLQVM+HQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN
Sbjct: 1 MKHLLMTLFSSPESLLQVMNHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_045141535.1 MULTISPECIES: hypothetical protein [Enterobacter cloacae complex]
KJI66955.1 hypothetical protein UO88_02115 [Enterobacter
cloacae] CZW80729.1 Uncharacterised protein
[Enterobacter cloacae] SAC01203.1 Uncharacterised
protein [Enterobacter cloacae] SAD55866.1
Uncharacterised protein [Enterobacter cloacae]
SAB61246.1 Uncharacterised protein [Enterobacter
cloacae] KZR21305.1 hypothetical protein A3N67_19855
[Enterobacter hormaechei subsp. steigerwaltii]
Length = 65
Score = 129 bits (323), Expect = 2e-37
Identities = 64/65 (98%), Positives = 65/65 (100%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYK+HEVRQDFLRHVN
Sbjct: 1 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKNHEVRQDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_023314096.1 MULTISPECIES: hypothetical protein [Enterobacter cloacae complex]
ESM50864.1 hypothetical protein L400_00258 [Enterobacter
cloacae BWH 29] EUL62918.1 hypothetical protein
P838_04253 [Enterobacter cloacae UCI 35] EUL63500.1
hypothetical protein P839_03913 [Enterobacter cloacae
UCI 36] KJO81147.1 hypothetical protein SR98_06300
[Enterobacter hormaechei subsp. oharae] KJP33145.1
hypothetical protein SR78_11160 [Enterobacter hormaechei
subsp. oharae] KUQ32156.1 hypothetical protein
AWI13_08775 [Enterobacter hormaechei subsp. oharae]
KUQ94934.1 hypothetical protein AWI29_12365
[Enterobacter hormaechei subsp. oharae]
Length = 65
Score = 128 bits (321), Expect = 5e-37
Identities = 64/65 (98%), Positives = 64/65 (98%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGD IIIDQDGNASVNYKSHEVRQDFLRHVN
Sbjct: 1 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDHIIIDQDGNASVNYKSHEVRQDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_022648035.1 MULTISPECIES: hypothetical protein [Enterobacteriaceae] ERP02960.1
hypothetical protein L354_01990 [Enterobacter sp. MGH 8]
ESL88583.1 hypothetical protein L420_03193 [Enterobacter
cloacae UCICRE 9] ESM16996.1 hypothetical protein
L414_02336 [Enterobacter cloacae UCICRE 3] ESN11962.1
hypothetical protein L372_02200 [Enterobacter sp. MGH
26] EUL37857.1 hypothetical protein P853_01100
[Enterobacter cloacae UCI 50] EUM35339.1 hypothetical
protein L407_02241 [Enterobacter sp. BWH 39] EUM64874.1
hypothetical protein L357_02288 [Enterobacter sp. MGH
11] EUM66702.1 hypothetical protein L358_00878
[Enterobacter sp. MGH 12] EUM68549.1 hypothetical
protein L359_04606 [Enterobacter cloacae 'Hoffmann
cluster III' MGH 13] EUM78556.1 hypothetical protein
L355_05667 [Enterobacter sp. MGH 9] EUM96137.1
hypothetical protein L351_05678 [Enterobacter sp. MGH 5]
EUM97720.1 hypothetical protein L350_05384 [Enterobacter
sp. MGH 4] EUN06299.1 hypothetical protein L348_06686
[Enterobacter sp. MGH 2] EZR14968.1 hypothetical protein
L398_02422 [Enterobacter sp. BWH 27] KDM52178.1
hypothetical protein AF34_03066 [Lelliottia amnigena CHS
78] AIN22658.1 hypothetical protein ECNIH3_10150
[Enterobacter cloacae ECNIH3] AIN28001.1 hypothetical
protein ECR091_10120 [Enterobacter cloacae ECR091]
AIX59384.1 hypothetical protein ECNIH5_11640
[Enterobacter cloacae] KJM74666.1 hypothetical protein
SS12_19305 [Enterobacter hormaechei] KJN18197.1
hypothetical protein SS58_03485 [Enterobacter
hormaechei] KJN91393.1 hypothetical protein SS05_11610
[Enterobacter hormaechei] KJN92604.1 hypothetical
protein SS04_13310 [Enterobacter hormaechei] KJN99762.1
hypothetical protein SS03_17305 [Enterobacter
hormaechei] KJO15974.1 hypothetical protein SR87_09765
[Enterobacter hormaechei] KJQ11957.1 hypothetical
protein VE18_13845 [Enterobacter cloacae] KKJ26182.1
hypothetical protein T637_20470 [Enterobacter
hormaechei] KLP93911.1 hypothetical protein ABR37_10465
[Enterobacter hormaechei] KLR20167.1 hypothetical
protein ABR28_17015 [Enterobacter hormaechei] KLW31555.1
hypothetical protein SK51_03209 [Enterobacter sp. MGH85]
KLW53539.1 hypothetical protein SK55_01955 [Enterobacter
sp. MGH127] KTH12776.1 hypothetical protein ASV31_16745
[Enterobacter hormaechei] KTI91880.1 hypothetical
protein ASU95_05075 [Enterobacter hormaechei] KTJ74083.1
hypothetical protein ASU76_04465 [Enterobacter
hormaechei] KTK00901.1 hypothetical protein ASU71_02560
[Enterobacter hormaechei] KTK14924.1 hypothetical
protein ASU67_04355 [Enterobacter hormaechei] KTK48189.1
hypothetical protein ASU64_00530 [Enterobacter
hormaechei] KVJ00681.1 hypothetical protein AWS42_07500
[Enterobacter hormaechei] KVK37125.1 hypothetical
protein ASU72_00830 [Enterobacter hormaechei] CZU66150.1
Uncharacterised protein [Enterobacter cloacae]
CZW92690.1 Uncharacterised protein [Enterobacter
cloacae] CZU23919.1 Uncharacterised protein
[Enterobacter cloacae] CZV80979.1 Uncharacterised
protein [Enterobacter cloacae] CZW44683.1
Uncharacterised protein [Enterobacter cloacae]
CZV05281.1 Uncharacterised protein [Enterobacter
cloacae] CZX66682.1 Uncharacterised protein
[Enterobacter cloacae] CZX96531.1 Uncharacterised
protein [Enterobacter cloacae] CZW01881.1
Uncharacterised protein [Enterobacter cloacae]
CZX36420.1 Uncharacterised protein [Enterobacter
cloacae] CZX21532.1 Uncharacterised protein
[Enterobacter cloacae] CZY01317.1 Uncharacterised
protein [Enterobacter cloacae] CZU61414.1
Uncharacterised protein [Enterobacter cloacae]
CZX08263.1 Uncharacterised protein [Enterobacter
cloacae] CZW91899.1 Uncharacterised protein
[Enterobacter cloacae] CZU88092.1 Uncharacterised
protein [Enterobacter cloacae] CZW35359.1
Uncharacterised protein [Enterobacter cloacae]
CZW96069.1 Uncharacterised protein [Enterobacter
cloacae] CZU29566.1 Uncharacterised protein
[Enterobacter cloacae] CZV40053.1 Uncharacterised
protein [Enterobacter cloacae] CZU79613.1
Uncharacterised protein [Enterobacter cloacae]
SAE92002.1 Uncharacterised protein [Enterobacter
cloacae] SAB77142.1 Uncharacterised protein
[Enterobacter cloacae] SAH14686.1 Uncharacterised
protein [Enterobacter cloacae] SAC98239.1
Uncharacterised protein [Enterobacter cloacae]
SAA27667.1 Uncharacterised protein [Enterobacter
cloacae] SAB18186.1 Uncharacterised protein
[Enterobacter cloacae] SAB48205.1 Uncharacterised
protein [Enterobacter cloacae] SAH67650.1
Uncharacterised protein [Enterobacter cloacae]
CZY35000.1 Uncharacterised protein [Enterobacter
cloacae] SAB76634.1 Uncharacterised protein
[Enterobacter cloacae] SAI53069.1 Uncharacterised
protein [Enterobacter cloacae] CZY98919.1
Uncharacterised protein [Enterobacter cloacae]
SAA84911.1 Uncharacterised protein [Enterobacter
cloacae] CZZ42296.1 Uncharacterised protein
[Enterobacter cloacae] SAC90591.1 Uncharacterised
protein [Enterobacter cloacae] SAA21816.1
Uncharacterised protein [Enterobacter cloacae]
SAD03760.1 Uncharacterised protein [Enterobacter
cloacae] SAD75788.1 Uncharacterised protein
[Enterobacter cloacae] SAF78832.1 Uncharacterised
protein [Enterobacter cloacae] SAB27074.1
Uncharacterised protein [Enterobacter cloacae]
SAH52128.1 Uncharacterised protein [Enterobacter
cloacae] SAD11241.1 Uncharacterised protein
[Enterobacter cloacae] SAE31632.1 Uncharacterised
protein [Enterobacter cloacae] SAD42448.1
Uncharacterised protein [Enterobacter cloacae]
SAD20915.1 Uncharacterised protein [Enterobacter
cloacae] SAC31499.1 Uncharacterised protein
[Enterobacter cloacae] SAA60655.1 Uncharacterised
protein [Enterobacter cloacae] SAE26196.1
Uncharacterised protein [Enterobacter cloacae]
SAB18450.1 Uncharacterised protein [Enterobacter
cloacae] SAD32524.1 Uncharacterised protein
[Enterobacter cloacae] SAG10033.1 Uncharacterised
protein [Enterobacter cloacae] SAE95903.1
Uncharacterised protein [Enterobacter cloacae]
SAC43442.1 Uncharacterised protein [Enterobacter
cloacae] SAD98427.1 Uncharacterised protein
[Enterobacter cloacae] SAB11767.1 Uncharacterised
protein [Enterobacter cloacae] SAF76092.1
Uncharacterised protein [Enterobacter cloacae]
SAA23930.1 Uncharacterised protein [Enterobacter
cloacae] CZY27301.1 Uncharacterised protein
[Enterobacter cloacae] SAD20562.1 Uncharacterised
protein [Enterobacter cloacae] SAG62838.1
Uncharacterised protein [Enterobacter cloacae]
SAD89710.1 Uncharacterised protein [Enterobacter
cloacae] SAA82119.1 Uncharacterised protein
[[Enterobacter] aerogenes] SAD81645.1 Uncharacterised
protein [Enterobacter cloacae] SAF47244.1
Uncharacterised protein [Enterobacter cloacae]
SAG40050.1 Uncharacterised protein [Enterobacter
cloacae] SAF57481.1 Uncharacterised protein
[Enterobacter cloacae] SAH37713.1 Uncharacterised
protein [Enterobacter cloacae] SAI95169.1
Uncharacterised protein [Enterobacter cloacae]
SAI89447.1 Uncharacterised protein [Enterobacter
cloacae] OAE42995.1 hypothetical protein A7J56_01760
[Enterobacter cloacae] OAE69248.1 hypothetical protein
A7J58_01775 [Enterobacter cloacae] OAZ43191.1
hypothetical protein A9Z41_15600 [Enterobacter cloacae]
AOP99878.1 hypothetical protein BFV65_09755
[Enterobacter cloacae complex 'Hoffmann cluster III']
OEG86268.1 hypothetical protein AN661_0220355
[Enterobacter cloacae complex 'Hoffmann cluster III']
Length = 65
Score = 122 bits (307), Expect = 7e-35
Identities = 62/65 (95%), Positives = 64/65 (98%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK+LLM LFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKS+EVRQDFLRHVN
Sbjct: 1 MKNLLMALFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSNEVRQDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_063451411.1 hypothetical protein [Enterobacter cloacae complex sp. GN06232]
KZR31053.1 hypothetical protein A3466_05380
[Enterobacter cloacae complex sp. GN06232]
Length = 65
Score = 121 bits (303), Expect = 3e-34
Identities = 61/65 (93%), Positives = 64/65 (98%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK+LLM LFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKS+EVR+DFLRHVN
Sbjct: 1 MKNLLMALFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSNEVRKDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_065544949.1 hypothetical protein [Enterobacter cloacae]
Length = 61
Score = 120 bits (302), Expect = 3e-34
Identities = 60/61 (98%), Positives = 61/61 (100%)
Frame = -1
Query: 280 LMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVNALKR 101
+MTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVNALKR
Sbjct: 1 MMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVNALKR 60
Query: 100 A 98
A
Sbjct: 61 A 61
>KJI79104.1 hypothetical protein UO82_13100 [Enterobacter cloacae]
Length = 60
Score = 120 bits (300), Expect = 7e-34
Identities = 60/60 (100%), Positives = 60/60 (100%)
Frame = -1
Query: 277 MTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVNALKRA 98
MTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVNALKRA
Sbjct: 1 MTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVNALKRA 60
>WP_006175081.1 hypothetical protein [Enterobacter cancerogenus] EFC57491.1
hypothetical protein ENTCAN_06008 [Enterobacter
cancerogenus ATCC 35316]
Length = 65
Score = 119 bits (299), Expect = 1e-33
Identities = 60/65 (92%), Positives = 63/65 (96%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK LLM LF+SPESLLQV+SHQEIIEAVEDGDRIIIDQDGNASVNYKS+EVRQDFLRHVN
Sbjct: 1 MKRLLMALFASPESLLQVISHQEIIEAVEDGDRIIIDQDGNASVNYKSNEVRQDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_006810544.1 hypothetical protein [Enterobacter hormaechei] EGK60158.1
hypothetical protein HMPREF9086_2264 [Enterobacter
hormaechei ATCC 49162] AJB70944.1 hypothetical protein
LI64_10465 [Enterobacter hormaechei subsp. hormaechei]
KJN39358.1 hypothetical protein SS25_12385 [Enterobacter
hormaechei subsp. hormaechei] KJO02422.1 hypothetical
protein SS00_09680 [Enterobacter hormaechei subsp.
hormaechei] KLR12983.1 hypothetical protein ABR27_14890
[Enterobacter hormaechei subsp. hormaechei] OIR52568.1
hypothetical protein BH712_02970 [Enterobacter
hormaechei ATCC 49162]
Length = 65
Score = 119 bits (298), Expect = 2e-33
Identities = 60/65 (92%), Positives = 64/65 (98%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK+LLM LFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDG+ASVNYKS+EVR+DFLRHVN
Sbjct: 1 MKNLLMALFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGSASVNYKSNEVRRDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_058608860.1 hypothetical protein [Enterobacter cancerogenus] KTQ49183.1
hypothetical protein NS104_03645 [Enterobacter
cancerogenus] KTQ51448.1 hypothetical protein
NS111_13230 [Enterobacter cancerogenus] KTQ69694.1
hypothetical protein NS188_20115 [Enterobacter
cancerogenus] KTQ79649.1 hypothetical protein
NS31R_13140 [Enterobacter cancerogenus]
Length = 65
Score = 118 bits (296), Expect = 3e-33
Identities = 59/65 (90%), Positives = 63/65 (96%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK LLM LF+SPESLLQV+SH+EIIEAVEDGDRIIIDQDGNASVNYKS+EVRQDFLRHVN
Sbjct: 1 MKRLLMALFASPESLLQVISHEEIIEAVEDGDRIIIDQDGNASVNYKSNEVRQDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_059357030.1 hypothetical protein [Enterobacter cloacae complex sp. GN05729]
Length = 65
Score = 117 bits (292), Expect = 1e-32
Identities = 59/65 (90%), Positives = 62/65 (95%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK L ++LFSSPESLLQVMS QEIIEAVEDGDRIIIDQDGNASVNYKS+EVRQDFLRHVN
Sbjct: 1 MKRLFLSLFSSPESLLQVMSQQEIIEAVEDGDRIIIDQDGNASVNYKSNEVRQDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_047027381.1 hypothetical protein [Enterobacter kobei] KLG25331.1 hypothetical
protein YA50_10235 [Enterobacter kobei]
Length = 65
Score = 116 bits (290), Expect = 3e-32
Identities = 58/65 (89%), Positives = 62/65 (95%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK + ++LFSSPESLLQVMS QEIIEAVEDGDRIIIDQDGNASVNYKS+EVRQDFLRHVN
Sbjct: 1 MKRIFLSLFSSPESLLQVMSQQEIIEAVEDGDRIIIDQDGNASVNYKSNEVRQDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_014883742.1 MULTISPECIES: hypothetical protein [Enterobacter] AFP69977.1
hypothetical protein ECENHK_10540 [Enterobacter cloacae
subsp. cloacae ENHKU01] ESN27018.1 hypothetical protein
L369_02418 [Enterobacter sp. MGH 23] ESN29105.1
hypothetical protein L368_01217 [Enterobacter sp. MGH
22] ESN31089.1 hypothetical protein L371_00206
[Enterobacter sp. MGH 25] EUL87431.1 hypothetical
protein P827_01936 [Enterobacter cloacae UCI 24]
EUM47331.1 hypothetical protein L383_01308 [Enterobacter
sp. MGH 37] KDF42185.1 hypothetical protein AE42_02524
[Enterobacter cloacae BIDMC 67] KDF76214.1 hypothetical
protein P832_01291 [Enterobacter cloacae UCI 29]
AIX54973.1 hypothetical protein ECNIH4_12220
[Enterobacter cloacae] KJM27982.1 hypothetical protein
SS27_21505 [Enterobacter kobei] KJM97598.1 hypothetical
protein SS33_00150 [Enterobacter kobei] KLG17456.1
hypothetical protein YA53_22615 [Enterobacter kobei]
KLP24218.1 hypothetical protein YA51_21385 [Enterobacter
kobei] KLP50376.1 hypothetical protein ABR40_11280
[Enterobacter kobei] KLP61785.1 hypothetical protein
ABR38_24030 [Enterobacter kobei] KLQ91418.1 hypothetical
protein ABR29_06310 [Enterobacter kobei] KLR22365.1
hypothetical protein ABR25_18975 [Enterobacter kobei]
KLR31196.1 hypothetical protein ABR24_13355
[Enterobacter kobei] KRS27498.1 hypothetical protein
Ent8706_23235 [Enterobacter cloacae] KTI67893.1
hypothetical protein ASV01_10720 [Enterobacter kobei]
KUQ01032.1 hypothetical protein AWI05_00255
[Enterobacter kobei] KYO16507.1 hypothetical protein
ABR31_0220230 [Enterobacter hormaechei subsp.
steigerwaltii] CZV81142.1 Uncharacterised protein
[Enterobacter cloacae] CZX36704.1 Uncharacterised
protein [Enterobacter cloacae] CZY43613.1
Uncharacterised protein [Enterobacter cloacae]
KZQ07404.1 hypothetical protein A3N51_01365
[Enterobacter kobei] KZQ68047.1 hypothetical protein
A3N62_09405 [Enterobacter kobei] SAZ30201.1
Uncharacterised protein [Enterobacter kobei] OEG97113.1
hypothetical protein AN674_0219630 [Enterobacter kobei]
OEH08983.1 hypothetical protein AN693_0208005
[Enterobacter kobei]
Length = 65
Score = 115 bits (289), Expect = 4e-32
Identities = 58/65 (89%), Positives = 62/65 (95%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK + ++LFSSPESLLQVMS QEIIEAVEDGDRIIIDQDGNASVNYKS+EVRQDFLRHVN
Sbjct: 1 MKRVFLSLFSSPESLLQVMSQQEIIEAVEDGDRIIIDQDGNASVNYKSNEVRQDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_008502331.1 MULTISPECIES: hypothetical protein [Enterobacteriaceae] EJO45831.1
hypothetical protein B498_3070 [Enterobacter sp. SST3]
EPR33591.1 hypothetical protein EcloH_2021 [Enterobacter
cloacae str. Hanford] EPY97050.1 hypothetical protein
L799_09510 [Enterobacter cloacae EC_38VIM1] ESL82222.1
hypothetical protein L423_00472 [Enterobacter cloacae
UCICRE 12] ESM82229.1 hypothetical protein L380_04160
[Enterobacter cloacae 'Hoffmann cluster IV' MGH 34]
ESN54458.1 hypothetical protein L362_01373 [Enterobacter
sp. MGH 16] AHE70637.1 hypothetical protein M942_14625
[Enterobacter cloacae P101] EUL65437.1 hypothetical
protein P842_01264 [Enterobacter cloacae UCI 39]
EUM08334.1 hypothetical protein L466_02632 [Enterobacter
sp. BIDMC 30] EUM30986.1 hypothetical protein L462_01312
[Enterobacter sp. BIDMC 26] KDF60537.1 hypothetical
protein AF35_00660 [Enterobacter cloacae CHS 79]
KDF62461.1 hypothetical protein AF40_01239 [Enterobacter
cloacae MGH 54] KHO34942.1 hypothetical protein
PI91_13200 [Enterobacter sp. FB] KIF85514.1 hypothetical
protein QY91_06620 [Enterobacter ludwigii] KJN32754.1
hypothetical protein SS37_00110 [Enterobacter cloacae
complex sp. 35699] KJQ39631.1 hypothetical protein
VE21_07155 [Enterobacter cloacae] KKA55370.1
hypothetical protein UP01_16650 [Enterobacter cloacae]
KLP41065.1 hypothetical protein ABR36_08580
[Enterobacter ludwigii] KLQ28637.1 hypothetical protein
ABR33_20955 [Enterobacter cloacae complex sp. GN02548]
KLR47100.1 hypothetical protein ABR23_07495
[Enterobacter ludwigii] AKM87515.1 hypothetical protein
ABT55_13130 [Enterobacter cloacae] KLW91883.1
hypothetical protein SP99_02103 [Enterobacter sp.
BIDMC92] KML20538.1 hypothetical protein VL10_21635
[Leclercia adecarboxylata] KMN65956.1 hypothetical
protein VK95_06660 [Leclercia sp. LK8] KSX61972.1
hypothetical protein APT89_17735 [Enterobacter sp.
50588862] KUQ43876.1 hypothetical protein AWI16_12890
[Enterobacter ludwigii] KYO05452.1 hypothetical protein
ABR30_0218365 [Enterobacter kobei] CZU20691.1
Uncharacterised protein [Enterobacter cloacae]
CZY63392.1 Uncharacterised protein [Enterobacter
cloacae] SAC82993.1 Uncharacterised protein
[Enterobacter cloacae] SAH90101.1 Uncharacterised
protein [Enterobacter cloacae] SAH45566.1
Uncharacterised protein [Enterobacter cloacae]
SAB42420.1 Uncharacterised protein [Enterobacter
cloacae] SAE80811.1 Uncharacterised protein
[Enterobacter cloacae] SAI22836.1 Uncharacterised
protein [Enterobacter cloacae] SAA06392.1
Uncharacterised protein [Enterobacter cloacae]
SAD13145.1 Uncharacterised protein [Enterobacter
cloacae] SAF11257.1 Uncharacterised protein
[Enterobacter cloacae] KZP49905.1 hypothetical protein
A3N37_14190 [Enterobacter ludwigii] KZP65123.1
hypothetical protein A3462_23260 [Enterobacter cloacae
complex sp. GN04787] KZP78118.1 hypothetical protein
A3460_22655 [Enterobacter cloacae complex 'Hoffmann
cluster IV'] KZQ23687.1 hypothetical protein A3461_14300
[Enterobacter cloacae complex 'Hoffmann cluster IV']
KZQ73985.1 hypothetical protein A3465_16630
[Enterobacter cloacae complex 'Hoffmann cluster IV']
KZR45232.1 hypothetical protein A3467_11145
[Enterobacter cloacae complex 'Hoffmann cluster IV']
OBS88788.1 hypothetical protein AYL25_09710
[Enterobacter asburiae] AOP95513.1 hypothetical protein
BFV67_10060 [Enterobacter cloacae complex 'Hoffmann
cluster IV'] OEH04572.1 hypothetical protein
AN685_0211945 [Enterobacter cloacae complex 'Hoffmann
cluster IV'] OEI77678.1 hypothetical protein BFG58_03805
[Enterobacter sp. ku-bf2] AOT42990.1 hypothetical
protein BH714_06670 [Enterobacter ludwigii] OFU66106.1
hypothetical protein HMPREF3143_19370 [Enterobacter sp.
HMSC16D10] SEO50392.1 hypothetical protein
SAMN03159286_0944 [Enterobacter sp. NFIX58] OHY47092.1
hypothetical protein BBX43_01725 [Enterobacter cloacae
complex 'Hoffmann cluster IV'] OHY71792.1 hypothetical
protein BB775_06565 [Enterobacter cloacae complex
'Hoffmann cluster IV'] SFH80957.1 hypothetical protein
SAMN03159336_0728 [Enterobacter sp. NFIX59] OIR49622.1
hypothetical protein BH716_13370 [Lelliottia
nimipressuralis] SHM57379.1 hypothetical protein
SAMN05428986_3034 [Enterobacter sp. PDC34]
Length = 65
Score = 115 bits (288), Expect = 5e-32
Identities = 58/65 (89%), Positives = 61/65 (93%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK ++LFSSPESLLQVMS QEIIEAVEDGDRIIIDQDGNASVNYKS+EVRQDFLRHVN
Sbjct: 1 MKRFFLSLFSSPESLLQVMSQQEIIEAVEDGDRIIIDQDGNASVNYKSNEVRQDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>AEW73520.1 hypothetical protein EcWSU1_02083 [Enterobacter cloacae EcWSU1]
Length = 66
Score = 115 bits (288), Expect = 5e-32
Identities = 58/65 (89%), Positives = 61/65 (93%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK ++LFSSPESLLQVMS QEIIEAVEDGDRIIIDQDGNASVNYKS+EVRQDFLRHVN
Sbjct: 2 MKRFFLSLFSSPESLLQVMSQQEIIEAVEDGDRIIIDQDGNASVNYKSNEVRQDFLRHVN 61
Query: 112 ALKRA 98
ALKRA
Sbjct: 62 ALKRA 66
>WP_044596378.1 MULTISPECIES: hypothetical protein [Enterobacter cloacae complex]
AKZ74027.1 hypothetical protein LI67_015230
[Enterobacter cloacae complex sp. 35734]
Length = 65
Score = 115 bits (287), Expect = 7e-32
Identities = 58/65 (89%), Positives = 61/65 (93%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK ++LFSSPESLLQVMS QEIIEAVEDGDRIIIDQDGNASVNYKS+EVRQDFLRHVN
Sbjct: 1 MKRFFLSLFSSPESLLQVMSKQEIIEAVEDGDRIIIDQDGNASVNYKSNEVRQDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_047633558.1 hypothetical protein [Enterobacter cloacae] KGY62736.1 hypothetical
protein MC67_01100 [Enterobacter cloacae]
Length = 65
Score = 115 bits (287), Expect = 7e-32
Identities = 58/65 (89%), Positives = 61/65 (93%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK L ++LFSSPESLLQVMS QEIIEAVEDGDRIIIDQDGNASVNYKS+EVRQDFLRHVN
Sbjct: 1 MKRLFLSLFSSPESLLQVMSQQEIIEAVEDGDRIIIDQDGNASVNYKSNEVRQDFLRHVN 60
Query: 112 ALKRA 98
LKRA
Sbjct: 61 MLKRA 65
>WP_059179008.1 hypothetical protein [Lelliottia amnigena]
Length = 65
Score = 114 bits (286), Expect = 1e-31
Identities = 57/65 (87%), Positives = 62/65 (95%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK + M++FSSPESLLQVMS QEIIEAVEDGDRIIIDQDGNASVN+KS+EVRQDFLRHVN
Sbjct: 1 MKRIFMSVFSSPESLLQVMSQQEIIEAVEDGDRIIIDQDGNASVNFKSNEVRQDFLRHVN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65
>WP_041689413.1 hypothetical protein [Enterobacter sp. 638]
Length = 65
Score = 114 bits (285), Expect = 1e-31
Identities = 57/65 (87%), Positives = 61/65 (93%)
Frame = -1
Query: 292 MKHLLMTLFSSPESLLQVMSHQEIIEAVEDGDRIIIDQDGNASVNYKSHEVRQDFLRHVN 113
MK L M++FSSPESLLQVMS QEIIEAVEDGDRIIIDQDGNASVN+KS EVRQDFLRH+N
Sbjct: 1 MKRLFMSVFSSPESLLQVMSQQEIIEAVEDGDRIIIDQDGNASVNFKSKEVRQDFLRHIN 60
Query: 112 ALKRA 98
ALKRA
Sbjct: 61 ALKRA 65