BLASTX nr result
ID: Glycyrrhiza28_contig00024714
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00024714 (232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013463788.1 ankyrin repeat protein EMB506 [Medicago truncatul... 54 1e-06 XP_004488279.1 PREDICTED: ankyrin repeat domain-containing prote... 53 2e-06 >XP_013463788.1 ankyrin repeat protein EMB506 [Medicago truncatula] KEH37823.1 ankyrin repeat protein EMB506 [Medicago truncatula] Length = 229 Score = 53.5 bits (127), Expect = 1e-06 Identities = 27/55 (49%), Positives = 35/55 (63%) Frame = -3 Query: 176 MLQPNQADMDIICKPNKNKELGRNQILAVTXXXXXXXXXMRASDLKVMWRKKRQR 12 MLQ NQA+ ++CKPNKN E G+ QI VT ++A DLK+M +KRQR Sbjct: 1 MLQSNQAEEYLLCKPNKNFEPGKTQIFVVTATMSMVMKKIKALDLKMMGNRKRQR 55 >XP_004488279.1 PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Cicer arietinum] XP_012574772.1 PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Cicer arietinum] Length = 330 Score = 53.1 bits (126), Expect = 2e-06 Identities = 26/42 (61%), Positives = 29/42 (69%) Frame = -2 Query: 228 KGKFSLSFARDTYKALSHVATKSSRHGYYLQTQQEQGTWEEP 103 K KF LSF+RD Y+ S+ A K SR Y QTQQE GTWEEP Sbjct: 43 KEKFCLSFSRDNYEVGSNFAIKLSREVSYSQTQQEHGTWEEP 84