BLASTX nr result
ID: Glycyrrhiza28_contig00024686
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00024686 (419 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU38853.1 hypothetical protein TSUD_154150 [Trifolium subterran... 54 5e-07 >GAU38853.1 hypothetical protein TSUD_154150 [Trifolium subterraneum] Length = 77 Score = 53.9 bits (128), Expect = 5e-07 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = +3 Query: 3 GGSDSPFLSQKREEAHKGCVNSVYAKDRKSNFTQTQS 113 GGSDSPF KREE KGCVNS AK+ K NFTQT S Sbjct: 29 GGSDSPFFRLKREEVCKGCVNSNCAKNHKGNFTQTDS 65