BLASTX nr result
ID: Glycyrrhiza28_contig00024558
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00024558 (297 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004513543.1 PREDICTED: BTB/POZ domain-containing protein At3g... 118 3e-29 XP_014632305.1 PREDICTED: BTB/POZ domain-containing protein At3g... 118 3e-29 XP_006582341.1 PREDICTED: BTB/POZ domain-containing protein At3g... 118 3e-29 KHN41194.1 BTB/POZ domain-containing protein [Glycine soja] 118 3e-29 XP_003527477.1 PREDICTED: BTB/POZ domain-containing protein At3g... 118 3e-29 XP_004513542.1 PREDICTED: BTB/POZ domain-containing protein At3g... 118 3e-29 XP_014523755.1 PREDICTED: BTB/POZ domain-containing protein At3g... 117 8e-29 KYP50331.1 BTB/POZ domain-containing protein At1g30440 family [C... 117 1e-28 XP_014523754.1 PREDICTED: BTB/POZ domain-containing protein At3g... 117 1e-28 XP_007132585.1 hypothetical protein PHAVU_011G107300g [Phaseolus... 117 1e-28 XP_017431512.1 PREDICTED: BTB/POZ domain-containing protein At3g... 115 3e-28 XP_006592399.1 PREDICTED: BTB/POZ domain-containing protein At3g... 114 7e-28 XP_003539880.1 PREDICTED: BTB/POZ domain-containing protein At3g... 114 8e-28 XP_013455544.1 phototropic-responsive NPH3 family protein [Medic... 112 4e-27 XP_002281337.2 PREDICTED: BTB/POZ domain-containing protein At3g... 100 1e-22 ONI18558.1 hypothetical protein PRUPE_3G223000 [Prunus persica] ... 99 2e-22 ONI18554.1 hypothetical protein PRUPE_3G223000 [Prunus persica] 99 3e-22 XP_007215642.1 hypothetical protein PRUPE_ppa003887mg [Prunus pe... 99 3e-22 XP_008341965.1 PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-co... 99 3e-22 XP_016188379.1 PREDICTED: BTB/POZ domain-containing protein At3g... 98 6e-22 >XP_004513543.1 PREDICTED: BTB/POZ domain-containing protein At3g22104 isoform X2 [Cicer arietinum] Length = 526 Score = 118 bits (296), Expect = 3e-29 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 YAGNFD+ DNEKLRAHLQGMQWRVMELEK CRKMQ QMAKMTKSKASGHSY+KSLPKLC Sbjct: 466 YAGNFDIQPDNEKLRAHLQGMQWRVMELEKICRKMQTQMAKMTKSKASGHSYAKSLPKLC 525 Query: 115 S 113 S Sbjct: 526 S 526 >XP_014632305.1 PREDICTED: BTB/POZ domain-containing protein At3g22104-like isoform X3 [Glycine max] Length = 529 Score = 118 bits (296), Expect = 3e-29 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 Y+GNFDLS DNEKL+AHLQGMQWRVMELEKFCRKMQ QMAK+TKSKASGHSY+KSLPKLC Sbjct: 469 YSGNFDLSTDNEKLKAHLQGMQWRVMELEKFCRKMQIQMAKITKSKASGHSYAKSLPKLC 528 Query: 115 S 113 S Sbjct: 529 S 529 >XP_006582341.1 PREDICTED: BTB/POZ domain-containing protein At3g22104-like isoform X2 [Glycine max] KRH56085.1 hypothetical protein GLYMA_06G302100 [Glycine max] Length = 530 Score = 118 bits (296), Expect = 3e-29 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 Y+GNFDLS DNEKL+AHLQGMQWRVMELEKFCRKMQ QMAK+TKSKASGHSY+KSLPKLC Sbjct: 470 YSGNFDLSTDNEKLKAHLQGMQWRVMELEKFCRKMQIQMAKITKSKASGHSYAKSLPKLC 529 Query: 115 S 113 S Sbjct: 530 S 530 >KHN41194.1 BTB/POZ domain-containing protein [Glycine soja] Length = 543 Score = 118 bits (296), Expect = 3e-29 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 Y+GNFDLS DNEKL+AHLQGMQWRVMELEKFCRKMQ QMAK+TKSKASGHSY+KSLPKLC Sbjct: 483 YSGNFDLSTDNEKLKAHLQGMQWRVMELEKFCRKMQIQMAKITKSKASGHSYAKSLPKLC 542 Query: 115 S 113 S Sbjct: 543 S 543 >XP_003527477.1 PREDICTED: BTB/POZ domain-containing protein At3g22104-like isoform X1 [Glycine max] KRH56084.1 hypothetical protein GLYMA_06G302100 [Glycine max] Length = 543 Score = 118 bits (296), Expect = 3e-29 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 Y+GNFDLS DNEKL+AHLQGMQWRVMELEKFCRKMQ QMAK+TKSKASGHSY+KSLPKLC Sbjct: 483 YSGNFDLSTDNEKLKAHLQGMQWRVMELEKFCRKMQIQMAKITKSKASGHSYAKSLPKLC 542 Query: 115 S 113 S Sbjct: 543 S 543 >XP_004513542.1 PREDICTED: BTB/POZ domain-containing protein At3g22104 isoform X1 [Cicer arietinum] Length = 544 Score = 118 bits (296), Expect = 3e-29 Identities = 55/61 (90%), Positives = 57/61 (93%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 YAGNFD+ DNEKLRAHLQGMQWRVMELEK CRKMQ QMAKMTKSKASGHSY+KSLPKLC Sbjct: 484 YAGNFDIQPDNEKLRAHLQGMQWRVMELEKICRKMQTQMAKMTKSKASGHSYAKSLPKLC 543 Query: 115 S 113 S Sbjct: 544 S 544 >XP_014523755.1 PREDICTED: BTB/POZ domain-containing protein At3g22104 isoform X2 [Vigna radiata var. radiata] Length = 480 Score = 117 bits (292), Expect = 8e-29 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 YAGNFDLS DNEKL+AHLQGMQWRVMELEKFCRKMQ QMAK+TKSKASG+SY+KSLPKLC Sbjct: 420 YAGNFDLSTDNEKLKAHLQGMQWRVMELEKFCRKMQVQMAKITKSKASGNSYAKSLPKLC 479 Query: 115 S 113 S Sbjct: 480 S 480 >KYP50331.1 BTB/POZ domain-containing protein At1g30440 family [Cajanus cajan] Length = 539 Score = 117 bits (292), Expect = 1e-28 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 YA NFDLS DNEKL+AHLQGMQWRVMELEKFCRKMQ QMAK+TKSKASGHSY+KSLPKLC Sbjct: 479 YADNFDLSTDNEKLKAHLQGMQWRVMELEKFCRKMQIQMAKITKSKASGHSYAKSLPKLC 538 Query: 115 S 113 S Sbjct: 539 S 539 >XP_014523754.1 PREDICTED: BTB/POZ domain-containing protein At3g22104 isoform X1 [Vigna radiata var. radiata] Length = 542 Score = 117 bits (292), Expect = 1e-28 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 YAGNFDLS DNEKL+AHLQGMQWRVMELEKFCRKMQ QMAK+TKSKASG+SY+KSLPKLC Sbjct: 482 YAGNFDLSTDNEKLKAHLQGMQWRVMELEKFCRKMQVQMAKITKSKASGNSYAKSLPKLC 541 Query: 115 S 113 S Sbjct: 542 S 542 >XP_007132585.1 hypothetical protein PHAVU_011G107300g [Phaseolus vulgaris] ESW04579.1 hypothetical protein PHAVU_011G107300g [Phaseolus vulgaris] Length = 542 Score = 117 bits (292), Expect = 1e-28 Identities = 55/61 (90%), Positives = 59/61 (96%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 YAGNFDLS DNEKL+AHLQGMQWRVMELEKFCRKMQ QMAK+TKSKASG+SY+KSLPKLC Sbjct: 482 YAGNFDLSTDNEKLKAHLQGMQWRVMELEKFCRKMQVQMAKITKSKASGNSYTKSLPKLC 541 Query: 115 S 113 S Sbjct: 542 S 542 >XP_017431512.1 PREDICTED: BTB/POZ domain-containing protein At3g22104 [Vigna angularis] KOM50437.1 hypothetical protein LR48_Vigan08g126400 [Vigna angularis] BAT90245.1 hypothetical protein VIGAN_06145100 [Vigna angularis var. angularis] Length = 542 Score = 115 bits (289), Expect = 3e-28 Identities = 54/61 (88%), Positives = 59/61 (96%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 YAGNFDL+ DNEKL+AHLQGMQWRVMELEKFCRKMQ QMAK+TKSKASG+SY+KSLPKLC Sbjct: 482 YAGNFDLATDNEKLKAHLQGMQWRVMELEKFCRKMQVQMAKITKSKASGNSYAKSLPKLC 541 Query: 115 S 113 S Sbjct: 542 S 542 >XP_006592399.1 PREDICTED: BTB/POZ domain-containing protein At3g22104-like isoform X2 [Glycine max] KRH25432.1 hypothetical protein GLYMA_12G102300 [Glycine max] Length = 527 Score = 114 bits (286), Expect = 7e-28 Identities = 53/61 (86%), Positives = 57/61 (93%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 Y+ NFD+S DNEKL AHLQGMQWRVMELEKFCRKMQ QMAK+TKSKASGHSY+KSLPKLC Sbjct: 467 YSSNFDISTDNEKLEAHLQGMQWRVMELEKFCRKMQIQMAKITKSKASGHSYAKSLPKLC 526 Query: 115 S 113 S Sbjct: 527 S 527 >XP_003539880.1 PREDICTED: BTB/POZ domain-containing protein At3g22104-like isoform X1 [Glycine max] KHN22858.1 BTB/POZ domain-containing protein [Glycine soja] KRH25431.1 hypothetical protein GLYMA_12G102300 [Glycine max] Length = 540 Score = 114 bits (286), Expect = 8e-28 Identities = 53/61 (86%), Positives = 57/61 (93%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 Y+ NFD+S DNEKL AHLQGMQWRVMELEKFCRKMQ QMAK+TKSKASGHSY+KSLPKLC Sbjct: 480 YSSNFDISTDNEKLEAHLQGMQWRVMELEKFCRKMQIQMAKITKSKASGHSYAKSLPKLC 539 Query: 115 S 113 S Sbjct: 540 S 540 >XP_013455544.1 phototropic-responsive NPH3 family protein [Medicago truncatula] KEH29575.1 phototropic-responsive NPH3 family protein [Medicago truncatula] Length = 545 Score = 112 bits (281), Expect = 4e-27 Identities = 51/61 (83%), Positives = 55/61 (90%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 YAGNFD+ DNEK++ HLQGMQWRVMELEK C+KMQ QMAKMTKSKASGHSY KSLPKLC Sbjct: 485 YAGNFDIQPDNEKMKEHLQGMQWRVMELEKVCKKMQTQMAKMTKSKASGHSYGKSLPKLC 544 Query: 115 S 113 S Sbjct: 545 S 545 >XP_002281337.2 PREDICTED: BTB/POZ domain-containing protein At3g22104 [Vitis vinifera] CBI17965.3 unnamed protein product, partial [Vitis vinifera] Length = 544 Score = 100 bits (248), Expect = 1e-22 Identities = 47/61 (77%), Positives = 52/61 (85%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 YAG D+SADNE+LRAHLQGMQWRVMELEK CRKMQ QMAK+ KSK + HS + SLPKLC Sbjct: 484 YAGKLDISADNERLRAHLQGMQWRVMELEKACRKMQTQMAKIMKSKTTSHSNAISLPKLC 543 Query: 115 S 113 S Sbjct: 544 S 544 >ONI18558.1 hypothetical protein PRUPE_3G223000 [Prunus persica] ONI18559.1 hypothetical protein PRUPE_3G223000 [Prunus persica] ONI18560.1 hypothetical protein PRUPE_3G223000 [Prunus persica] Length = 454 Score = 99.4 bits (246), Expect = 2e-22 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 YAG +L+ADNEKLRAHLQGMQ RVMELEK C+KMQ QMAK TKS+AS HS+++S+PKLC Sbjct: 394 YAGKLNLAADNEKLRAHLQGMQCRVMELEKLCKKMQTQMAKFTKSRASSHSHTRSVPKLC 453 Query: 115 S 113 S Sbjct: 454 S 454 >ONI18554.1 hypothetical protein PRUPE_3G223000 [Prunus persica] Length = 522 Score = 99.4 bits (246), Expect = 3e-22 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 YAG +L+ADNEKLRAHLQGMQ RVMELEK C+KMQ QMAK TKS+AS HS+++S+PKLC Sbjct: 462 YAGKLNLAADNEKLRAHLQGMQCRVMELEKLCKKMQTQMAKFTKSRASSHSHTRSVPKLC 521 Query: 115 S 113 S Sbjct: 522 S 522 >XP_007215642.1 hypothetical protein PRUPE_ppa003887mg [Prunus persica] ONI18555.1 hypothetical protein PRUPE_3G223000 [Prunus persica] ONI18556.1 hypothetical protein PRUPE_3G223000 [Prunus persica] ONI18557.1 hypothetical protein PRUPE_3G223000 [Prunus persica] Length = 542 Score = 99.4 bits (246), Expect = 3e-22 Identities = 46/61 (75%), Positives = 54/61 (88%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 YAG +L+ADNEKLRAHLQGMQ RVMELEK C+KMQ QMAK TKS+AS HS+++S+PKLC Sbjct: 482 YAGKLNLAADNEKLRAHLQGMQCRVMELEKLCKKMQTQMAKFTKSRASSHSHTRSVPKLC 541 Query: 115 S 113 S Sbjct: 542 S 542 >XP_008341965.1 PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein At3g22104 [Malus domestica] Length = 545 Score = 99.4 bits (246), Expect = 3e-22 Identities = 47/61 (77%), Positives = 53/61 (86%) Frame = -3 Query: 295 YAGNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLC 116 YAG LS DNEKLRAH+QGMQ RVMELEK C+KMQ+QMAK TKSKAS HS+++SLPKLC Sbjct: 485 YAGKLGLSTDNEKLRAHVQGMQCRVMELEKVCKKMQSQMAKFTKSKASSHSHTRSLPKLC 544 Query: 115 S 113 S Sbjct: 545 S 545 >XP_016188379.1 PREDICTED: BTB/POZ domain-containing protein At3g22104 isoform X4 [Arachis ipaensis] Length = 498 Score = 98.2 bits (243), Expect = 6e-22 Identities = 44/59 (74%), Positives = 53/59 (89%) Frame = -3 Query: 289 GNFDLSADNEKLRAHLQGMQWRVMELEKFCRKMQNQMAKMTKSKASGHSYSKSLPKLCS 113 G+FD S+DNE+L+AHLQGMQWRVMELEK C+KMQ QMAK+TKSK +SY++SLPKLCS Sbjct: 440 GDFDASSDNERLKAHLQGMQWRVMELEKICKKMQTQMAKITKSKVPPNSYARSLPKLCS 498