BLASTX nr result
ID: Glycyrrhiza28_contig00024409
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00024409 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU37519.1 hypothetical protein TSUD_21240 [Trifolium subterraneum] 96 9e-21 XP_007145693.1 hypothetical protein PHAVU_007G260300g [Phaseolus... 88 4e-18 XP_004497890.1 PREDICTED: probable L-type lectin-domain containi... 87 8e-18 XP_003518050.1 PREDICTED: probable L-type lectin-domain containi... 82 5e-16 KYP35808.1 Lectin-domain containing receptor kinase A4.2 [Cajanu... 79 4e-15 XP_006587205.1 PREDICTED: probable L-type lectin-domain containi... 79 6e-15 XP_013443401.1 lectin receptor kinase [Medicago truncatula] KEH1... 77 2e-14 XP_007145695.1 hypothetical protein PHAVU_007G260500g [Phaseolus... 76 7e-14 XP_013443403.1 lectin receptor kinase [Medicago truncatula] KEH1... 69 2e-11 XP_017412847.1 PREDICTED: probable L-type lectin-domain containi... 65 4e-10 XP_007145694.1 hypothetical protein PHAVU_007G260400g [Phaseolus... 64 8e-10 XP_014511368.1 PREDICTED: probable L-type lectin-domain containi... 62 4e-09 KHN11036.1 Putative L-type lectin-domain containing receptor kin... 62 7e-09 XP_006587207.1 PREDICTED: probable L-type lectin-domain containi... 62 7e-09 XP_014512792.1 PREDICTED: probable L-type lectin-domain containi... 60 2e-08 XP_016725857.1 PREDICTED: probable L-type lectin-domain containi... 60 2e-08 XP_012467968.1 PREDICTED: probable L-type lectin-domain containi... 60 2e-08 XP_017619882.1 PREDICTED: probable L-type lectin-domain containi... 59 6e-08 XP_016738268.1 PREDICTED: probable L-type lectin-domain containi... 59 6e-08 EOY09506.1 Concanavalin A-like lectin protein kinase family prot... 58 2e-07 >GAU37519.1 hypothetical protein TSUD_21240 [Trifolium subterraneum] Length = 676 Score = 95.5 bits (236), Expect = 9e-21 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = +3 Query: 156 IISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKNYS 314 IISL K+ CFYFNFPTFQP DE+N LLLSKNSKIYLDAIQ+TPDIRGEIKNYS Sbjct: 16 IISLRKINCFYFNFPTFQPNDESN-LLLSKNSKIYLDAIQVTPDIRGEIKNYS 67 >XP_007145693.1 hypothetical protein PHAVU_007G260300g [Phaseolus vulgaris] ESW17687.1 hypothetical protein PHAVU_007G260300g [Phaseolus vulgaris] Length = 707 Score = 87.8 bits (216), Expect = 4e-18 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKNYS 314 + I+LTKV CF+FNFPTFQPQDE+N LLL KN+KIYLDAIQ+TPDIRG I NYS Sbjct: 54 VTIALTKVTCFHFNFPTFQPQDESN-LLLHKNAKIYLDAIQVTPDIRGPIHNYS 106 >XP_004497890.1 PREDICTED: probable L-type lectin-domain containing receptor kinase S.5 [Cicer arietinum] Length = 662 Score = 87.0 bits (214), Expect = 8e-18 Identities = 46/53 (86%), Positives = 46/53 (86%) Frame = +3 Query: 156 IISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKNYS 314 II LTKV FYFNFPTFQP DEAN LLLSKNSKIYLDAIQITPDIRG I NYS Sbjct: 18 IIFLTKVTSFYFNFPTFQPNDEAN-LLLSKNSKIYLDAIQITPDIRGIIVNYS 69 >XP_003518050.1 PREDICTED: probable L-type lectin-domain containing receptor kinase S.5 [Glycine max] KHN09370.1 Putative L-type lectin-domain containing receptor kinase S.5 [Glycine soja] KRH71840.1 hypothetical protein GLYMA_02G172200 [Glycine max] Length = 668 Score = 82.0 bits (201), Expect = 5e-16 Identities = 40/54 (74%), Positives = 47/54 (87%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKNYS 314 III+LTKV CFYFNFPTFQ +D + LLLSKNS+IY DAIQ+TPDIRG I++YS Sbjct: 17 IIITLTKVTCFYFNFPTFQ-KDNESELLLSKNSQIYFDAIQVTPDIRGPIQDYS 69 >KYP35808.1 Lectin-domain containing receptor kinase A4.2 [Cajanus cajan] Length = 657 Score = 79.3 bits (194), Expect = 4e-15 Identities = 37/54 (68%), Positives = 45/54 (83%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKNYS 314 +I++LT V C YFNF TF+P+DEA LLL++NSKIYLD IQ+TPDIRG I NYS Sbjct: 17 VIVALTNVTCLYFNFTTFKPEDEAR-LLLNQNSKIYLDVIQVTPDIRGPISNYS 69 >XP_006587205.1 PREDICTED: probable L-type lectin-domain containing receptor kinase S.5 [Glycine max] KHN11032.1 Putative L-type lectin-domain containing receptor kinase S.5 [Glycine soja] KRH38091.1 hypothetical protein GLYMA_09G110500 [Glycine max] Length = 668 Score = 79.0 bits (193), Expect = 6e-15 Identities = 40/54 (74%), Positives = 47/54 (87%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKNYS 314 III+LTKV CFYFNF TFQ ++E++ LLLSKNS IYLDAIQ+TPDIRG I +YS Sbjct: 17 IIITLTKVTCFYFNFLTFQKENESD-LLLSKNSLIYLDAIQVTPDIRGRIHDYS 69 >XP_013443401.1 lectin receptor kinase [Medicago truncatula] KEH17426.1 lectin receptor kinase [Medicago truncatula] Length = 662 Score = 77.4 bits (189), Expect = 2e-14 Identities = 37/53 (69%), Positives = 42/53 (79%) Frame = +3 Query: 156 IISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKNYS 314 II+LTKV FYFNFPTFQ D + LLLSK + IY DAIQ+TPD RGEI+NYS Sbjct: 12 IIALTKVNSFYFNFPTFQQSDRSTKLLLSKFANIYKDAIQVTPDNRGEIENYS 64 >XP_007145695.1 hypothetical protein PHAVU_007G260500g [Phaseolus vulgaris] ESW17689.1 hypothetical protein PHAVU_007G260500g [Phaseolus vulgaris] Length = 657 Score = 75.9 bits (185), Expect = 7e-14 Identities = 41/55 (74%), Positives = 46/55 (83%), Gaps = 1/55 (1%) Frame = +3 Query: 153 IIISLTKV-GCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKNYS 314 II+SLTKV YFNFP+FQPQDEA+ LLL+ NSKI LDAIQ+TPDIRG I NYS Sbjct: 17 IILSLTKVTSSLYFNFPSFQPQDEAD-LLLNGNSKISLDAIQVTPDIRGPITNYS 70 >XP_013443403.1 lectin receptor kinase [Medicago truncatula] KEH17428.1 lectin receptor kinase [Medicago truncatula] Length = 658 Score = 68.6 bits (166), Expect = 2e-11 Identities = 35/54 (64%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = +3 Query: 156 IISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGE-IKNYS 314 II+LTKV FYFNFPTFQ D + + LLSK S IY D IQ+TPD RG I NYS Sbjct: 19 IIALTKVNSFYFNFPTFQQSDRSTNFLLSKYSNIYKDDIQVTPDNRGSPISNYS 72 >XP_017412847.1 PREDICTED: probable L-type lectin-domain containing receptor kinase S.5 [Vigna angularis] KOM34091.1 hypothetical protein LR48_Vigan02g024100 [Vigna angularis] Length = 666 Score = 65.1 bits (157), Expect = 4e-10 Identities = 33/54 (61%), Positives = 43/54 (79%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKNYS 314 + I+LTKV CF FNFP+F P D ++L +SKNS I+LDAIQ++PDIRG I +YS Sbjct: 18 VTIALTKVTCFKFNFPSF-PDD--SNLWVSKNSSIFLDAIQVSPDIRGRIDHYS 68 >XP_007145694.1 hypothetical protein PHAVU_007G260400g [Phaseolus vulgaris] ESW17688.1 hypothetical protein PHAVU_007G260400g [Phaseolus vulgaris] Length = 663 Score = 64.3 bits (155), Expect = 8e-10 Identities = 30/54 (55%), Positives = 40/54 (74%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKNYS 314 + I+LTKV CF+FNF TFQ ++ + + L KNS I+ DAIQ+TPDI G I NY+ Sbjct: 17 VTIALTKVSCFHFNFSTFQ--EDESDIWLHKNSNIFFDAIQVTPDIGGPIHNYA 68 >XP_014511368.1 PREDICTED: probable L-type lectin-domain containing receptor kinase S.5 [Vigna radiata var. radiata] Length = 670 Score = 62.4 bits (150), Expect = 4e-09 Identities = 32/54 (59%), Positives = 42/54 (77%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKNYS 314 + I+LTKV C FNFP+F P D ++L +SKNS I+LDAIQ++PDIRG I +YS Sbjct: 18 VTIALTKVTCLKFNFPSF-PDD--SNLWVSKNSSIFLDAIQVSPDIRGPIDHYS 68 >KHN11036.1 Putative L-type lectin-domain containing receptor kinase S.5 [Glycine soja] Length = 671 Score = 61.6 bits (148), Expect = 7e-09 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGE-IKNYS 314 IIISLTKV C FNF TF+ +DE + LLL+ NSKI+ AIQ+TPD R + I NYS Sbjct: 17 IIISLTKVTCLSFNFSTFERKDE-DHLLLNNNSKIFSSAIQVTPDTRAQSIHNYS 70 >XP_006587207.1 PREDICTED: probable L-type lectin-domain containing receptor kinase S.5 [Glycine max] KRH38093.1 hypothetical protein GLYMA_09G110700 [Glycine max] Length = 671 Score = 61.6 bits (148), Expect = 7e-09 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGE-IKNYS 314 IIISLTKV C FNF TF+ +DE + LLL+ NSKI+ AIQ+TPD R + I NYS Sbjct: 17 IIISLTKVTCLSFNFSTFERKDE-DHLLLNNNSKIFSSAIQVTPDTRAQSIHNYS 70 >XP_014512792.1 PREDICTED: probable L-type lectin-domain containing receptor kinase S.5 [Vigna radiata var. radiata] Length = 666 Score = 60.5 bits (145), Expect = 2e-08 Identities = 31/54 (57%), Positives = 42/54 (77%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKNYS 314 + ++LTKV CF FNFP+F D++N LLL +S+I+LDAIQ+T D RG I+NYS Sbjct: 18 VTVALTKVTCFQFNFPSFP--DDSNLLLLG-SSRIFLDAIQVTLDSRGTIENYS 68 >XP_016725857.1 PREDICTED: probable L-type lectin-domain containing receptor kinase S.5 [Gossypium hirsutum] Length = 657 Score = 60.1 bits (144), Expect = 2e-08 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKN 308 I++S KV CF F F FQ ++ LLLSKNS I+ DAIQITPD+ G+IKN Sbjct: 16 IVVSCIKVQCFDFKFSDFQ-EENRKDLLLSKNSTIFRDAIQITPDLNGDIKN 66 >XP_012467968.1 PREDICTED: probable L-type lectin-domain containing receptor kinase S.5 [Gossypium raimondii] KJB16336.1 hypothetical protein B456_002G224100 [Gossypium raimondii] Length = 657 Score = 60.1 bits (144), Expect = 2e-08 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKN 308 I++S KV CF F F FQ ++ LLLSKNS I+ DAIQITPD+ G+IKN Sbjct: 16 IVVSCIKVQCFDFKFSDFQ-EENRKDLLLSKNSTIFRDAIQITPDLNGDIKN 66 >XP_017619882.1 PREDICTED: probable L-type lectin-domain containing receptor kinase S.5 [Gossypium arboreum] Length = 657 Score = 58.9 bits (141), Expect = 6e-08 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKN 308 I++S KV CF F F F+ ++ LLLSKNS I+ DAIQITPD+ G+IKN Sbjct: 16 IVVSCIKVQCFDFKFSDFE-EENRKDLLLSKNSTIFRDAIQITPDLNGDIKN 66 >XP_016738268.1 PREDICTED: probable L-type lectin-domain containing receptor kinase S.5 [Gossypium hirsutum] Length = 657 Score = 58.9 bits (141), Expect = 6e-08 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = +3 Query: 153 IIISLTKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKN 308 I++S KV CF F F F+ ++ LLLSKNS I+ DAIQITPD+ G+IKN Sbjct: 16 IVVSCIKVQCFDFKFSDFE-EENRKDLLLSKNSTIFRDAIQITPDLNGDIKN 66 >EOY09506.1 Concanavalin A-like lectin protein kinase family protein, putative [Theobroma cacao] Length = 658 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/47 (57%), Positives = 35/47 (74%) Frame = +3 Query: 168 TKVGCFYFNFPTFQPQDEANSLLLSKNSKIYLDAIQITPDIRGEIKN 308 T V CFYFNFP FQ +D + L LS+NS I+ DA+Q+TPD+ G+I N Sbjct: 22 TNVQCFYFNFPDFQDEDRKD-LDLSENSTIFRDAMQVTPDLNGDITN 67