BLASTX nr result
ID: Glycyrrhiza28_contig00024275
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00024275 (966 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH44038.1 hypothetical protein GLYMA_08G186200 [Glycine max] 106 5e-23 XP_006585480.1 PREDICTED: uncharacterized protein At1g10890 isof... 63 1e-08 >KRH44038.1 hypothetical protein GLYMA_08G186200 [Glycine max] Length = 315 Score = 106 bits (265), Expect = 5e-23 Identities = 50/66 (75%), Positives = 56/66 (84%) Frame = +1 Query: 700 MESKGYEQVLGSGKCFFHCSIVTFASPCRKRWSTQWLFLAIYEVTVHVFEFRTLEGGQDL 879 M S+GYEQV+G+ + FFHCSIVTFAS C KRWSTQWLFLAI EVTVHVF F L+GG+ L Sbjct: 1 MGSEGYEQVMGADRVFFHCSIVTFASSCDKRWSTQWLFLAISEVTVHVFVFSVLDGGKHL 60 Query: 880 YSLKIA 897 YSLKIA Sbjct: 61 YSLKIA 66 >XP_006585480.1 PREDICTED: uncharacterized protein At1g10890 isoform X1 [Glycine max] Length = 330 Score = 63.2 bits (152), Expect(2) = 1e-08 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +1 Query: 769 FASPCRKRWSTQWLFLAIYEVTVHVFEFRTLEGGQDLYSLKIA 897 ++S RWSTQWLFLAI EVTVHVF F L+GG+ LYSLKIA Sbjct: 39 YSSYSYNRWSTQWLFLAISEVTVHVFVFSVLDGGKHLYSLKIA 81 Score = 25.0 bits (53), Expect(2) = 1e-08 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +2 Query: 899 FQLLRFIAYDHL 934 F LLRFIAYDH+ Sbjct: 82 FLLLRFIAYDHV 93