BLASTX nr result
ID: Glycyrrhiza28_contig00024179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00024179 (464 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABN08144.1 RNA-directed DNA polymerase ; HMG-I and HMG-Y, DNA-bi... 98 9e-23 ABN08636.1 Polyprotein, putative [Medicago truncatula] 96 1e-22 ABD28426.2 RNA-directed DNA polymerase (Reverse transcriptase) [... 96 3e-20 ABB00038.1 reverse transcriptase family member [Glycine max] 92 5e-19 KYP77525.1 Retrovirus-related Pol polyprotein LINE-1, partial [C... 84 2e-16 ABN09815.1 hypothetical protein MtrDRAFT_AC167711g37v2 [Medicago... 78 8e-16 XP_013445846.1 adenosine/AMP deaminase [Medicago truncatula] KEH... 83 9e-16 KYP34423.1 Retrovirus-related Pol polyprotein LINE-1 [Cajanus ca... 80 9e-15 KYP56875.1 Retrovirus-related Pol polyprotein LINE-1 [Cajanus ca... 80 9e-15 KYP65542.1 hypothetical protein KK1_011783, partial [Cajanus cajan] 78 1e-14 ABD32368.2 RNA-directed DNA polymerase ; HMG-I and HMG-Y, DNA-bi... 75 1e-14 KRG93547.1 hypothetical protein GLYMA_19G023400, partial [Glycin... 79 2e-14 KYP48577.1 hypothetical protein KK1_029728, partial [Cajanus cajan] 75 3e-14 AQK40494.1 La-related protein 6B [Zea mays] 75 6e-14 AGT15956.1 hypothetical protein SHCRBa_145_O03_R_70 [Saccharum h... 75 7e-14 AEL30343.1 RNA-directed DNA polymerase [Arachis hypogaea] 77 1e-13 AEL30371.1 TIR-NBS-LRR type disease resistance protein [Arachis ... 77 2e-13 AEJ72569.1 putative reverse transcriptase family member [Malus d... 74 4e-13 AQL04461.1 Retrovirus-related Pol polyprotein LINE-1 [Zea mays] 74 5e-13 XP_003593597.1 telomerase activating protein Est1 [Medicago trun... 75 7e-13 >ABN08144.1 RNA-directed DNA polymerase ; HMG-I and HMG-Y, DNA-binding, putative [Medicago truncatula] Length = 195 Score = 98.2 bits (243), Expect = 9e-23 Identities = 50/70 (71%), Positives = 54/70 (77%) Frame = -2 Query: 211 KVGDHIIPQVA*LIV*ISWVHYTNDREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLK 32 KVGDHIIPQV S+V ND EIE DV+HRIQ GWLKWR+AS VLCDKK+PLKLK Sbjct: 69 KVGDHIIPQVTRFKYLGSFVQ--NDGEIEADVSHRIQAGWLKWRRASGVLCDKKVPLKLK 126 Query: 31 GKFYCTTIRP 2 GKFY T IRP Sbjct: 127 GKFYRTAIRP 136 >ABN08636.1 Polyprotein, putative [Medicago truncatula] Length = 116 Score = 95.5 bits (236), Expect = 1e-22 Identities = 47/70 (67%), Positives = 54/70 (77%) Frame = -2 Query: 211 KVGDHIIPQVA*LIV*ISWVHYTNDREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLK 32 KVG+HIIPQ+ S V ND EI+ DV+HRIQ GWLKWR+AS VLCDKK+PLKLK Sbjct: 41 KVGEHIIPQITRFKYLGSIVQ--NDEEIKADVSHRIQAGWLKWRRASGVLCDKKVPLKLK 98 Query: 31 GKFYCTTIRP 2 GKFY TT+RP Sbjct: 99 GKFYRTTVRP 108 >ABD28426.2 RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 517 Score = 95.9 bits (237), Expect = 3e-20 Identities = 48/70 (68%), Positives = 53/70 (75%) Frame = -2 Query: 211 KVGDHIIPQVA*LIV*ISWVHYTNDREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLK 32 KVGDHIIPQV S+V ND EIE DV+HRIQ GWLKWR+AS VLCDKK+PLKL Sbjct: 431 KVGDHIIPQVTRFKYLGSFVQ--NDGEIEADVSHRIQAGWLKWRRASSVLCDKKVPLKLT 488 Query: 31 GKFYCTTIRP 2 GKFY T +RP Sbjct: 489 GKFYRTAVRP 498 >ABB00038.1 reverse transcriptase family member [Glycine max] Length = 377 Score = 91.7 bits (226), Expect = 5e-19 Identities = 45/70 (64%), Positives = 52/70 (74%) Frame = -2 Query: 211 KVGDHIIPQVA*LIV*ISWVHYTNDREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLK 32 K+GDHIIPQV S + +D EIE DVNHRIQ GW+KWRKAS VLCD K+P+KLK Sbjct: 177 KIGDHIIPQVTRFKYLGSVIQ--DDGEIEGDVNHRIQAGWMKWRKASGVLCDAKVPIKLK 234 Query: 31 GKFYCTTIRP 2 GKFY T +RP Sbjct: 235 GKFYRTAVRP 244 >KYP77525.1 Retrovirus-related Pol polyprotein LINE-1, partial [Cajanus cajan] Length = 366 Score = 84.3 bits (207), Expect = 2e-16 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = -2 Query: 142 NDREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 N+ EIE DVNHRIQ GW+KWRKAS V+CDKK+PLKLKGKFY T IRP Sbjct: 187 NNGEIEEDVNHRIQAGWMKWRKASGVICDKKVPLKLKGKFYRTAIRP 233 >ABN09815.1 hypothetical protein MtrDRAFT_AC167711g37v2 [Medicago truncatula] Length = 104 Score = 77.8 bits (190), Expect = 8e-16 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -2 Query: 118 VNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 V+HRIQVGWLKWR+AS VLCDKK+PLKLKGKFY TT+RP Sbjct: 7 VSHRIQVGWLKWRRASSVLCDKKVPLKLKGKFYRTTVRP 45 >XP_013445846.1 adenosine/AMP deaminase [Medicago truncatula] KEH19872.1 adenosine/AMP deaminase [Medicago truncatula] Length = 486 Score = 83.2 bits (204), Expect = 9e-16 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -2 Query: 148 YTNDREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 + ND EIE VNHR+Q GWLKWR+ S VLCDKK+PLKLKGKFY TT+RP Sbjct: 112 HKNDGEIEAYVNHRMQAGWLKWRRVSGVLCDKKVPLKLKGKFYHTTVRP 160 >KYP34423.1 Retrovirus-related Pol polyprotein LINE-1 [Cajanus cajan] Length = 819 Score = 80.5 bits (197), Expect = 9e-15 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -2 Query: 139 DREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 D E+E DV+HRIQ GW+KWR+AS VLCDKK+PLKLKGKFY T +RP Sbjct: 641 DAELEGDVHHRIQAGWMKWRRASGVLCDKKVPLKLKGKFYRTAVRP 686 >KYP56875.1 Retrovirus-related Pol polyprotein LINE-1 [Cajanus cajan] Length = 925 Score = 80.5 bits (197), Expect = 9e-15 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -2 Query: 139 DREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 D E+E DV+HRIQ GW+KWR+AS VLCDKK+PLKLKGKFY T +RP Sbjct: 833 DAELEGDVHHRIQAGWMKWRRASGVLCDKKVPLKLKGKFYRTAVRP 878 >KYP65542.1 hypothetical protein KK1_011783, partial [Cajanus cajan] Length = 248 Score = 78.2 bits (191), Expect = 1e-14 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 139 DREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 D E+E DV+HRIQ GW+KWR+AS VLCDKK+P KLKGKFY T +RP Sbjct: 70 DAELEGDVHHRIQAGWMKWRRASGVLCDKKVPRKLKGKFYRTAVRP 115 >ABD32368.2 RNA-directed DNA polymerase ; HMG-I and HMG-Y, DNA-binding, putative [Medicago truncatula] Length = 118 Score = 75.1 bits (183), Expect = 1e-14 Identities = 38/70 (54%), Positives = 43/70 (61%) Frame = -2 Query: 211 KVGDHIIPQVA*LIV*ISWVHYTNDREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLK 32 KVGDHI+ QV +RIQ GWLKWR+ASDVLCDKK+ LKLK Sbjct: 17 KVGDHIVSQVT---------------------RYRIQAGWLKWRRASDVLCDKKVLLKLK 55 Query: 31 GKFYCTTIRP 2 GKFY TT+RP Sbjct: 56 GKFYRTTVRP 65 >KRG93547.1 hypothetical protein GLYMA_19G023400, partial [Glycine max] Length = 471 Score = 79.3 bits (194), Expect = 2e-14 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -2 Query: 154 VHYTNDREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 +H +D E E DVNHRIQ GW+KWRKAS VLCD K+ +KLKGKFY T IRP Sbjct: 374 IHLIDDGETEGDVNHRIQAGWMKWRKASGVLCDAKVLIKLKGKFYRTAIRP 424 >KYP48577.1 hypothetical protein KK1_029728, partial [Cajanus cajan] Length = 174 Score = 75.5 bits (184), Expect = 3e-14 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -2 Query: 121 DVNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 DV+HRIQ GW+KWR+AS VLCDKK+PLKLKGKFY T +RP Sbjct: 2 DVHHRIQAGWMKWRRASGVLCDKKVPLKLKGKFYRTAVRP 41 >AQK40494.1 La-related protein 6B [Zea mays] Length = 191 Score = 75.1 bits (183), Expect = 6e-14 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = -2 Query: 139 DREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 D +I+ DV+HRI+ GW+KWR+AS V+CDK++P KLKGKFY TTIRP Sbjct: 37 DGDIDEDVSHRIKAGWMKWRQASGVICDKRVPQKLKGKFYRTTIRP 82 >AGT15956.1 hypothetical protein SHCRBa_145_O03_R_70 [Saccharum hybrid cultivar R570] AGT16280.1 hypothetical protein SHCRBa_093_A03_R_70 [Saccharum hybrid cultivar R570] AGT16831.1 putative kinase protein [Saccharum hybrid cultivar R570] AGT17118.1 hypothetical protein SHCRBa_045_A10_R_70 [Saccharum hybrid cultivar R570] Length = 215 Score = 75.5 bits (184), Expect = 7e-14 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 139 DREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 D +I+ DV HRI VGWLKWR+AS VLCDK++P KLKGKFY T IRP Sbjct: 38 DGDIDEDVRHRISVGWLKWRQASGVLCDKRVPQKLKGKFYRTAIRP 83 >AEL30343.1 RNA-directed DNA polymerase [Arachis hypogaea] Length = 562 Score = 77.0 bits (188), Expect = 1e-13 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = -2 Query: 133 EIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 EIE DVNHRIQ GW KWR AS +CDKK+PLKLKGKFY T IRP Sbjct: 367 EIEQDVNHRIQAGWSKWRSASGFICDKKVPLKLKGKFYRTAIRP 410 >AEL30371.1 TIR-NBS-LRR type disease resistance protein [Arachis hypogaea] Length = 1939 Score = 77.0 bits (188), Expect = 2e-13 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = -2 Query: 133 EIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 EIE DVNHRIQ GW KWR AS +CDKK+PLKLKGKFY T IRP Sbjct: 1225 EIEQDVNHRIQAGWSKWRSASGFICDKKVPLKLKGKFYRTAIRP 1268 >AEJ72569.1 putative reverse transcriptase family member [Malus domestica] Length = 212 Score = 73.6 bits (179), Expect = 4e-13 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -2 Query: 133 EIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 E++ D+NHRIQ GW+KW+ AS VLCD+ +PLKLKGKFY TTIRP Sbjct: 35 ELDGDLNHRIQAGWMKWKSASGVLCDRCMPLKLKGKFYRTTIRP 78 >AQL04461.1 Retrovirus-related Pol polyprotein LINE-1 [Zea mays] Length = 233 Score = 73.6 bits (179), Expect = 5e-13 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = -2 Query: 139 DREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLKGKFYCTTIRP 2 D +I+ DV+HRI+VGW+KW +AS VLC+K++P KLKGKFY TTIRP Sbjct: 180 DGDIDEDVSHRIKVGWMKWHQASGVLCNKRVPQKLKGKFYRTTIRP 225 >XP_003593597.1 telomerase activating protein Est1 [Medicago truncatula] AES63848.1 telomerase activating protein Est1 [Medicago truncatula] Length = 1189 Score = 75.1 bits (183), Expect = 7e-13 Identities = 38/70 (54%), Positives = 43/70 (61%) Frame = -2 Query: 211 KVGDHIIPQVA*LIV*ISWVHYTNDREIEIDVNHRIQVGWLKWRKASDVLCDKKIPLKLK 32 KVGDHI+ QV +RIQ GWLKWR+ASDVLCDKK+ LKLK Sbjct: 1019 KVGDHIVSQVT---------------------RYRIQAGWLKWRRASDVLCDKKVLLKLK 1057 Query: 31 GKFYCTTIRP 2 GKFY TT+RP Sbjct: 1058 GKFYRTTVRP 1067