BLASTX nr result
ID: Glycyrrhiza28_contig00023870
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00023870 (342 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABY40731.1 FERONIA receptor-like kinase, partial [Citrus trifoli... 67 8e-11 GAU41020.1 hypothetical protein TSUD_178600 [Trifolium subterran... 67 8e-11 KDP21852.1 hypothetical protein JCGZ_00639 [Jatropha curcas] 67 9e-11 GAV91330.1 Pkinase_Tyr domain-containing protein/Malectin_like d... 67 9e-11 EYU42039.1 hypothetical protein MIMGU_mgv1a001343mg [Erythranthe... 67 9e-11 OIW01375.1 hypothetical protein TanjilG_12915 [Lupinus angustifo... 67 9e-11 KVH95034.1 Concanavalin A-like lectin/glucanase, subgroup [Cynar... 67 9e-11 XP_012832279.1 PREDICTED: receptor-like protein kinase FERONIA [... 67 9e-11 XP_010098025.1 Receptor-like protein kinase FERONIA [Morus notab... 67 9e-11 XP_017646177.1 PREDICTED: receptor-like protein kinase FERONIA [... 67 9e-11 XP_016694079.1 PREDICTED: receptor-like protein kinase FERONIA [... 67 9e-11 XP_012478290.1 PREDICTED: receptor-like protein kinase FERONIA [... 67 9e-11 XP_015897910.1 PREDICTED: receptor-like protein kinase FERONIA [... 67 9e-11 XP_012091030.1 PREDICTED: receptor-like protein kinase FERONIA [... 67 9e-11 XP_002528704.2 PREDICTED: receptor-like protein kinase FERONIA [... 67 9e-11 OMP10174.1 hypothetical protein COLO4_04754 [Corchorus olitorius] 67 9e-11 OAY41700.1 hypothetical protein MANES_09G122900 [Manihot esculenta] 67 9e-11 KDO64141.1 hypothetical protein CISIN_1g036624mg [Citrus sinensis] 67 9e-11 XP_016730935.1 PREDICTED: receptor-like protein kinase FERONIA [... 67 9e-11 XP_012487116.1 PREDICTED: receptor-like protein kinase FERONIA [... 67 9e-11 >ABY40731.1 FERONIA receptor-like kinase, partial [Citrus trifoliata] Length = 447 Score = 67.4 bits (163), Expect = 8e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 415 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 447 >GAU41020.1 hypothetical protein TSUD_178600 [Trifolium subterraneum] Length = 556 Score = 67.4 bits (163), Expect = 8e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 524 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 556 >KDP21852.1 hypothetical protein JCGZ_00639 [Jatropha curcas] Length = 652 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 620 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 652 >GAV91330.1 Pkinase_Tyr domain-containing protein/Malectin_like domain-containing protein [Cephalotus follicularis] Length = 808 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 776 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 808 >EYU42039.1 hypothetical protein MIMGU_mgv1a001343mg [Erythranthe guttata] Length = 837 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 805 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 837 >OIW01375.1 hypothetical protein TanjilG_12915 [Lupinus angustifolius] Length = 882 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 850 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 882 >KVH95034.1 Concanavalin A-like lectin/glucanase, subgroup [Cynara cardunculus var. scolymus] Length = 882 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 850 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 882 >XP_012832279.1 PREDICTED: receptor-like protein kinase FERONIA [Erythranthe guttata] XP_012832280.1 PREDICTED: receptor-like protein kinase FERONIA [Erythranthe guttata] Length = 884 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 852 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 884 >XP_010098025.1 Receptor-like protein kinase FERONIA [Morus notabilis] EXB74408.1 Receptor-like protein kinase FERONIA [Morus notabilis] Length = 888 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 856 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 888 >XP_017646177.1 PREDICTED: receptor-like protein kinase FERONIA [Gossypium arboreum] Length = 889 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 857 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 889 >XP_016694079.1 PREDICTED: receptor-like protein kinase FERONIA [Gossypium hirsutum] Length = 889 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 857 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 889 >XP_012478290.1 PREDICTED: receptor-like protein kinase FERONIA [Gossypium raimondii] KJB29840.1 hypothetical protein B456_005G120700 [Gossypium raimondii] Length = 889 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 857 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 889 >XP_015897910.1 PREDICTED: receptor-like protein kinase FERONIA [Ziziphus jujuba] Length = 891 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 859 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 891 >XP_012091030.1 PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas] Length = 891 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 859 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 891 >XP_002528704.2 PREDICTED: receptor-like protein kinase FERONIA [Ricinus communis] EEF33694.1 kinase, putative [Ricinus communis] Length = 891 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 859 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 891 >OMP10174.1 hypothetical protein COLO4_04754 [Corchorus olitorius] Length = 892 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 860 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 892 >OAY41700.1 hypothetical protein MANES_09G122900 [Manihot esculenta] Length = 893 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 861 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 893 >KDO64141.1 hypothetical protein CISIN_1g036624mg [Citrus sinensis] Length = 893 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 861 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 893 >XP_016730935.1 PREDICTED: receptor-like protein kinase FERONIA [Gossypium hirsutum] Length = 895 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 863 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 895 >XP_012487116.1 PREDICTED: receptor-like protein kinase FERONIA [Gossypium raimondii] KJB38065.1 hypothetical protein B456_006G235700 [Gossypium raimondii] Length = 895 Score = 67.4 bits (163), Expect = 9e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -3 Query: 340 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 242 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 863 MSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 895