BLASTX nr result
ID: Glycyrrhiza28_contig00023855
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00023855 (209 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP69162.1 Pentatricopeptide repeat-containing protein At2g35130... 95 4e-21 XP_013470288.1 PPR containing plant-like protein [Medicago trunc... 94 7e-21 XP_006605878.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 1e-20 XP_003555869.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 1e-20 KRG90712.1 hypothetical protein GLYMA_20G109800 [Glycine max] 94 1e-20 XP_004497161.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 5e-20 XP_007142837.1 hypothetical protein PHAVU_007G021100g [Phaseolus... 91 6e-20 XP_007142836.1 hypothetical protein PHAVU_007G021100g [Phaseolus... 91 6e-20 XP_007142838.1 hypothetical protein PHAVU_007G021100g [Phaseolus... 91 6e-20 KHG03951.1 hypothetical protein F383_09329 [Gossypium arboreum] 91 8e-20 XP_017647045.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 9e-20 XP_016701250.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 9e-20 XP_016725911.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 9e-20 XP_012454306.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 9e-20 KJB69895.1 hypothetical protein B456_011G048600, partial [Gossyp... 91 9e-20 KDO77373.1 hypothetical protein CISIN_1g036275mg [Citrus sinensis] 88 1e-19 XP_006448704.1 hypothetical protein CICLE_v10015335mg [Citrus cl... 90 2e-19 KOM36383.1 hypothetical protein LR48_Vigan02g253300 [Vigna angul... 89 3e-19 XP_017413921.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 3e-19 XP_014512726.1 PREDICTED: pentatricopeptide repeat-containing pr... 89 3e-19 >KYP69162.1 Pentatricopeptide repeat-containing protein At2g35130 family [Cajanus cajan] Length = 558 Score = 94.7 bits (234), Expect = 4e-21 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMIDAGCYPDGGTAKVLLAACSNEDQT+QVT VIRTMHKD+KAVLP+ Sbjct: 511 EEMIDAGCYPDGGTAKVLLAACSNEDQTQQVTTVIRTMHKDIKAVLPV 558 >XP_013470288.1 PPR containing plant-like protein [Medicago truncatula] KEH44326.1 PPR containing plant-like protein [Medicago truncatula] Length = 559 Score = 94.0 bits (232), Expect = 7e-21 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMIDAGCYPDGGTAKVLLAACSNEDQ EQVT+VIRTMHKDMK VLP+ Sbjct: 511 EEMIDAGCYPDGGTAKVLLAACSNEDQIEQVTSVIRTMHKDMKTVLPV 558 >XP_006605878.1 PREDICTED: pentatricopeptide repeat-containing protein At2g35130 isoform X2 [Glycine max] KHN11471.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 558 Score = 93.6 bits (231), Expect = 1e-20 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMID GCYPDGGTAKVLLAACSNEDQTEQVT VIRTMHKDMK VLP+ Sbjct: 511 EEMIDDGCYPDGGTAKVLLAACSNEDQTEQVTTVIRTMHKDMKTVLPV 558 >XP_003555869.1 PREDICTED: pentatricopeptide repeat-containing protein At2g35130 isoform X1 [Glycine max] Length = 576 Score = 93.6 bits (231), Expect = 1e-20 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMID GCYPDGGTAKVLLAACSNEDQTEQVT VIRTMHKDMK VLP+ Sbjct: 529 EEMIDDGCYPDGGTAKVLLAACSNEDQTEQVTTVIRTMHKDMKTVLPV 576 >KRG90712.1 hypothetical protein GLYMA_20G109800 [Glycine max] Length = 625 Score = 93.6 bits (231), Expect = 1e-20 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMID GCYPDGGTAKVLLAACSNEDQTEQVT VIRTMHKDMK VLP+ Sbjct: 578 EEMIDDGCYPDGGTAKVLLAACSNEDQTEQVTTVIRTMHKDMKTVLPV 625 >XP_004497161.1 PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Cicer arietinum] Length = 578 Score = 91.7 bits (226), Expect = 5e-20 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMID GCYPDGGTAKVLLAACSNEDQ EQVT+VIRTMHKDMK VLP+ Sbjct: 530 EEMIDDGCYPDGGTAKVLLAACSNEDQIEQVTSVIRTMHKDMKTVLPV 577 >XP_007142837.1 hypothetical protein PHAVU_007G021100g [Phaseolus vulgaris] ESW14831.1 hypothetical protein PHAVU_007G021100g [Phaseolus vulgaris] Length = 558 Score = 91.3 bits (225), Expect = 6e-20 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMIDAGCYPDGGTAKVLLAACSNEDQ EQVT VIRTMHKDMK LP+ Sbjct: 511 EEMIDAGCYPDGGTAKVLLAACSNEDQKEQVTTVIRTMHKDMKTELPV 558 >XP_007142836.1 hypothetical protein PHAVU_007G021100g [Phaseolus vulgaris] ESW14830.1 hypothetical protein PHAVU_007G021100g [Phaseolus vulgaris] Length = 576 Score = 91.3 bits (225), Expect = 6e-20 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMIDAGCYPDGGTAKVLLAACSNEDQ EQVT VIRTMHKDMK LP+ Sbjct: 529 EEMIDAGCYPDGGTAKVLLAACSNEDQKEQVTTVIRTMHKDMKTELPV 576 >XP_007142838.1 hypothetical protein PHAVU_007G021100g [Phaseolus vulgaris] ESW14832.1 hypothetical protein PHAVU_007G021100g [Phaseolus vulgaris] Length = 578 Score = 91.3 bits (225), Expect = 6e-20 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMIDAGCYPDGGTAKVLLAACSNEDQ EQVT VIRTMHKDMK LP+ Sbjct: 531 EEMIDAGCYPDGGTAKVLLAACSNEDQKEQVTTVIRTMHKDMKTELPV 578 >KHG03951.1 hypothetical protein F383_09329 [Gossypium arboreum] Length = 545 Score = 90.9 bits (224), Expect = 8e-20 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMIDAGCYPDGGTAKVLL+ACS+EDQ EQVT VIRTMHKDMK VLP+ Sbjct: 498 EEMIDAGCYPDGGTAKVLLSACSSEDQIEQVTTVIRTMHKDMKTVLPI 545 >XP_017647045.1 PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Gossypium arboreum] XP_017647046.1 PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Gossypium arboreum] Length = 578 Score = 90.9 bits (224), Expect = 9e-20 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMIDAGCYPDGGTAKVLL+ACS+EDQ EQVT VIRTMHKDMK VLP+ Sbjct: 531 EEMIDAGCYPDGGTAKVLLSACSSEDQIEQVTTVIRTMHKDMKTVLPI 578 >XP_016701250.1 PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like [Gossypium hirsutum] Length = 578 Score = 90.9 bits (224), Expect = 9e-20 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMIDAGCYPDGGTAKVLL+ACS+EDQ EQVT VIRTMHKDMK VLP+ Sbjct: 531 EEMIDAGCYPDGGTAKVLLSACSSEDQIEQVTTVIRTMHKDMKTVLPI 578 >XP_016725911.1 PREDICTED: pentatricopeptide repeat-containing protein At2g35130-like [Gossypium hirsutum] Length = 578 Score = 90.9 bits (224), Expect = 9e-20 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMIDAGCYPDGGTAKVLL+ACS+EDQ EQVT VIRTMHKDMK VLP+ Sbjct: 531 EEMIDAGCYPDGGTAKVLLSACSSEDQIEQVTTVIRTMHKDMKTVLPI 578 >XP_012454306.1 PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Gossypium raimondii] XP_012454307.1 PREDICTED: pentatricopeptide repeat-containing protein At2g35130 [Gossypium raimondii] Length = 578 Score = 90.9 bits (224), Expect = 9e-20 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMIDAGCYPDGGTAKVLL+ACS+EDQ EQVT VIRTMHKDMK VLP+ Sbjct: 531 EEMIDAGCYPDGGTAKVLLSACSSEDQIEQVTTVIRTMHKDMKTVLPI 578 >KJB69895.1 hypothetical protein B456_011G048600, partial [Gossypium raimondii] Length = 595 Score = 90.9 bits (224), Expect = 9e-20 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMIDAGCYPDGGTAKVLL+ACS+EDQ EQVT VIRTMHKDMK VLP+ Sbjct: 548 EEMIDAGCYPDGGTAKVLLSACSSEDQIEQVTTVIRTMHKDMKTVLPI 595 >KDO77373.1 hypothetical protein CISIN_1g036275mg [Citrus sinensis] Length = 271 Score = 88.2 bits (217), Expect = 1e-19 Identities = 41/55 (74%), Positives = 47/55 (85%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPLV*AFELY 165 EEMIDAGCYPDGGTAKVL++ACS+EDQ EQVT ++RTMHKDMK LP+ F LY Sbjct: 203 EEMIDAGCYPDGGTAKVLISACSSEDQIEQVTTLVRTMHKDMKTALPIY--FNLY 255 >XP_006448704.1 hypothetical protein CICLE_v10015335mg [Citrus clementina] ESR61944.1 hypothetical protein CICLE_v10015335mg [Citrus clementina] Length = 427 Score = 89.7 bits (221), Expect = 2e-19 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPLV*AFELY 165 EEMIDAGCYPDGGTAKVL++ACS+EDQ EQVT ++RTMHKDMKA LP+ F LY Sbjct: 374 EEMIDAGCYPDGGTAKVLISACSSEDQIEQVTTLVRTMHKDMKAALPIY--FNLY 426 >KOM36383.1 hypothetical protein LR48_Vigan02g253300 [Vigna angularis] Length = 568 Score = 89.4 bits (220), Expect = 3e-19 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMID+GCYPDGGTAKVLLAACSN+DQTEQVT VIRTMHKDM LP+ Sbjct: 521 EEMIDSGCYPDGGTAKVLLAACSNQDQTEQVTTVIRTMHKDMNTELPV 568 >XP_017413921.1 PREDICTED: pentatricopeptide repeat-containing protein At2g35130 isoform X2 [Vigna angularis] Length = 576 Score = 89.4 bits (220), Expect = 3e-19 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMID+GCYPDGGTAKVLLAACSN+DQTEQVT VIRTMHKDM LP+ Sbjct: 529 EEMIDSGCYPDGGTAKVLLAACSNQDQTEQVTTVIRTMHKDMNTELPV 576 >XP_014512726.1 PREDICTED: pentatricopeptide repeat-containing protein At2g35130 isoform X2 [Vigna radiata var. radiata] Length = 576 Score = 89.4 bits (220), Expect = 3e-19 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = +1 Query: 1 EEMIDAGCYPDGGTAKVLLAACSNEDQTEQVTAVIRTMHKDMKAVLPL 144 EEMID+GCYPDGGTAKVLLAACSN+DQTEQVT VIRTMHKDM LP+ Sbjct: 529 EEMIDSGCYPDGGTAKVLLAACSNQDQTEQVTTVIRTMHKDMNTELPV 576