BLASTX nr result
ID: Glycyrrhiza28_contig00023633
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00023633 (401 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU48490.1 hypothetical protein TSUD_291750 [Trifolium subterran... 60 4e-09 >GAU48490.1 hypothetical protein TSUD_291750 [Trifolium subterraneum] Length = 124 Score = 60.5 bits (145), Expect = 4e-09 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +3 Query: 3 EADRDLEDQPRALLILQSTGQRHTRHTQMNHIS 101 EADRDLEDQPRALLILQSTGQRHTRHTQ S Sbjct: 67 EADRDLEDQPRALLILQSTGQRHTRHTQTKMFS 99