BLASTX nr result
ID: Glycyrrhiza28_contig00023590
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00023590 (277 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006577365.1 PREDICTED: B3 domain-containing transcription fac... 102 4e-24 XP_003520889.1 PREDICTED: B3 domain-containing transcription fac... 102 6e-24 XP_014624619.1 PREDICTED: B3 domain-containing transcription fac... 102 2e-23 GAU33583.1 hypothetical protein TSUD_359610 [Trifolium subterran... 101 2e-23 XP_007135337.1 hypothetical protein PHAVU_010G120900g [Phaseolus... 101 2e-23 XP_014624616.1 PREDICTED: B3 domain-containing protein Os02g0683... 102 2e-23 XP_016182613.1 PREDICTED: B3 domain-containing transcription fac... 101 3e-23 XP_013444525.1 B3 DNA-binding domain protein [Medicago truncatul... 101 3e-23 XP_015948137.1 PREDICTED: B3 domain-containing protein Os03g0120... 101 3e-23 KOM57227.1 hypothetical protein LR48_Vigan11g025900 [Vigna angul... 100 4e-23 XP_014521558.1 PREDICTED: B3 domain-containing transcription fac... 100 6e-23 XP_017442690.1 PREDICTED: B3 domain-containing transcription fac... 100 6e-23 XP_014521556.1 PREDICTED: B3 domain-containing transcription fac... 100 8e-23 XP_017442687.1 PREDICTED: B3 domain-containing transcription fac... 100 8e-23 XP_003529866.2 PREDICTED: B3 domain-containing protein Os03g0120... 99 2e-22 KRH47753.1 hypothetical protein GLYMA_07G048200 [Glycine max] 99 2e-22 KHN06382.1 B3 domain-containing protein [Glycine soja] 99 3e-22 XP_017409735.1 PREDICTED: B3 domain-containing transcription fac... 99 3e-22 XP_003553806.1 PREDICTED: B3 domain-containing transcription fac... 98 3e-22 XP_014499090.1 PREDICTED: B3 domain-containing transcription fac... 99 3e-22 >XP_006577365.1 PREDICTED: B3 domain-containing transcription factor NGA1-like isoform X2 [Glycine max] KRH68992.1 hypothetical protein GLYMA_03G262200 [Glycine max] Length = 370 Score = 102 bits (255), Expect = 4e-24 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIHEYQYHHPV 99 SYVMTKGWSRFVKEKKLDAGDIVSFQRG+G+LYRHRLYIDW+RR +H + H +H P+ Sbjct: 99 SYVMTKGWSRFVKEKKLDAGDIVSFQRGLGDLYRHRLYIDWKRRPDHAHAHPPHHHDPL 157 >XP_003520889.1 PREDICTED: B3 domain-containing transcription factor NGA1-like isoform X1 [Glycine max] XP_006577361.1 PREDICTED: B3 domain-containing transcription factor NGA1-like isoform X1 [Glycine max] XP_006577362.1 PREDICTED: B3 domain-containing transcription factor NGA1-like isoform X1 [Glycine max] XP_006577363.1 PREDICTED: B3 domain-containing transcription factor NGA1-like isoform X1 [Glycine max] XP_006577364.1 PREDICTED: B3 domain-containing transcription factor NGA1-like isoform X1 [Glycine max] XP_014629549.1 PREDICTED: B3 domain-containing transcription factor NGA1-like isoform X1 [Glycine max] KHN16393.1 B3 domain-containing transcription factor NGA1 [Glycine soja] KRH68988.1 hypothetical protein GLYMA_03G262200 [Glycine max] KRH68989.1 hypothetical protein GLYMA_03G262200 [Glycine max] KRH68990.1 hypothetical protein GLYMA_03G262200 [Glycine max] KRH68991.1 hypothetical protein GLYMA_03G262200 [Glycine max] Length = 420 Score = 102 bits (255), Expect = 6e-24 Identities = 45/59 (76%), Positives = 52/59 (88%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIHEYQYHHPV 99 SYVMTKGWSRFVKEKKLDAGDIVSFQRG+G+LYRHRLYIDW+RR +H + H +H P+ Sbjct: 149 SYVMTKGWSRFVKEKKLDAGDIVSFQRGLGDLYRHRLYIDWKRRPDHAHAHPPHHHDPL 207 >XP_014624619.1 PREDICTED: B3 domain-containing transcription factor NGA2-like isoform X2 [Glycine max] KRH06331.1 hypothetical protein GLYMA_16G017100 [Glycine max] KRH06332.1 hypothetical protein GLYMA_16G017100 [Glycine max] KRH06333.1 hypothetical protein GLYMA_16G017100 [Glycine max] Length = 502 Score = 102 bits (253), Expect = 2e-23 Identities = 47/60 (78%), Positives = 52/60 (86%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIHEYQYHHPVE 96 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGE YRHRLYIDW+RR +H H + +H PV+ Sbjct: 176 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGESYRHRLYIDWKRRRDH---HHHHHHGPVD 232 >GAU33583.1 hypothetical protein TSUD_359610 [Trifolium subterraneum] Length = 405 Score = 101 bits (251), Expect = 2e-23 Identities = 45/48 (93%), Positives = 48/48 (100%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHN 132 SYVMTKGWSRFVK+KKLDAGDIVSFQRGVGEL+RHRL+IDWRRRTNHN Sbjct: 104 SYVMTKGWSRFVKDKKLDAGDIVSFQRGVGELFRHRLFIDWRRRTNHN 151 >XP_007135337.1 hypothetical protein PHAVU_010G120900g [Phaseolus vulgaris] XP_007135338.1 hypothetical protein PHAVU_010G120900g [Phaseolus vulgaris] XP_007135339.1 hypothetical protein PHAVU_010G120900g [Phaseolus vulgaris] ESW07331.1 hypothetical protein PHAVU_010G120900g [Phaseolus vulgaris] ESW07332.1 hypothetical protein PHAVU_010G120900g [Phaseolus vulgaris] ESW07333.1 hypothetical protein PHAVU_010G120900g [Phaseolus vulgaris] Length = 476 Score = 101 bits (252), Expect = 2e-23 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIH 123 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRR +H++ H Sbjct: 178 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRPDHHHHH 228 >XP_014624616.1 PREDICTED: B3 domain-containing protein Os02g0683500-like isoform X1 [Glycine max] XP_014624617.1 PREDICTED: B3 domain-containing protein Os02g0683500-like isoform X1 [Glycine max] XP_014624618.1 PREDICTED: B3 domain-containing protein Os02g0683500-like isoform X1 [Glycine max] KHN15868.1 B3 domain-containing protein [Glycine soja] KRH06334.1 hypothetical protein GLYMA_16G017100 [Glycine max] Length = 582 Score = 102 bits (253), Expect = 2e-23 Identities = 47/60 (78%), Positives = 52/60 (86%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIHEYQYHHPVE 96 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGE YRHRLYIDW+RR +H H + +H PV+ Sbjct: 256 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGESYRHRLYIDWKRRRDH---HHHHHHGPVD 312 >XP_016182613.1 PREDICTED: B3 domain-containing transcription factor NGA3-like [Arachis ipaensis] Length = 493 Score = 101 bits (252), Expect = 3e-23 Identities = 51/91 (56%), Positives = 61/91 (67%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIHEYQYHHPVE 96 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGE YRHRLYIDWRRR ++++ H + H ++ Sbjct: 185 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGESYRHRLYIDWRRRPDNHHHHHHNLHGGLD 244 Query: 95 YXXXXXXXXXXXXXXPNQPLPAHLSSQYSMI 3 + +P+ SS YS I Sbjct: 245 FPSSSSNFITPFF------IPSQASSHYSTI 269 >XP_013444525.1 B3 DNA-binding domain protein [Medicago truncatula] KEH18550.1 B3 DNA-binding domain protein [Medicago truncatula] Length = 517 Score = 101 bits (252), Expect = 3e-23 Identities = 47/60 (78%), Positives = 52/60 (86%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIHEYQYHHPVE 96 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGEL+RHRL+IDWRRR+NHN HH ++ Sbjct: 233 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELFRHRLFIDWRRRSNHN-------HHTID 285 >XP_015948137.1 PREDICTED: B3 domain-containing protein Os03g0120900-like [Arachis duranensis] Length = 484 Score = 101 bits (251), Expect = 3e-23 Identities = 51/91 (56%), Positives = 61/91 (67%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIHEYQYHHPVE 96 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGE YRHRLYIDWRRR ++++ H + H ++ Sbjct: 183 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGENYRHRLYIDWRRRPDNHHHHHHNLHGGLD 242 Query: 95 YXXXXXXXXXXXXXXPNQPLPAHLSSQYSMI 3 + +P+ SS YS I Sbjct: 243 FPSSSSNFITPFF------IPSQASSHYSTI 267 >KOM57227.1 hypothetical protein LR48_Vigan11g025900 [Vigna angularis] Length = 414 Score = 100 bits (249), Expect = 4e-23 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIH 123 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVG+LYRHRLYIDWRRR +H++ H Sbjct: 113 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGDLYRHRLYIDWRRRPDHHHHH 163 >XP_014521558.1 PREDICTED: B3 domain-containing transcription factor NGA1-like isoform X2 [Vigna radiata var. radiata] Length = 479 Score = 100 bits (249), Expect = 6e-23 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIH 123 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVG+LYRHRLYIDWRRR +H++ H Sbjct: 179 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGDLYRHRLYIDWRRRPDHHHHH 229 >XP_017442690.1 PREDICTED: B3 domain-containing transcription factor NGA1 isoform X2 [Vigna angularis] Length = 480 Score = 100 bits (249), Expect = 6e-23 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIH 123 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVG+LYRHRLYIDWRRR +H++ H Sbjct: 179 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGDLYRHRLYIDWRRRPDHHHHH 229 >XP_014521556.1 PREDICTED: B3 domain-containing transcription factor NGA1-like isoform X1 [Vigna radiata var. radiata] XP_014521557.1 PREDICTED: B3 domain-containing transcription factor NGA1-like isoform X1 [Vigna radiata var. radiata] Length = 554 Score = 100 bits (249), Expect = 8e-23 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIH 123 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVG+LYRHRLYIDWRRR +H++ H Sbjct: 254 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGDLYRHRLYIDWRRRPDHHHHH 304 >XP_017442687.1 PREDICTED: B3 domain-containing transcription factor NGA1 isoform X1 [Vigna angularis] XP_017442688.1 PREDICTED: B3 domain-containing transcription factor NGA1 isoform X1 [Vigna angularis] XP_017442689.1 PREDICTED: B3 domain-containing transcription factor NGA1 isoform X1 [Vigna angularis] BAT98194.1 hypothetical protein VIGAN_09183200 [Vigna angularis var. angularis] Length = 555 Score = 100 bits (249), Expect = 8e-23 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIH 123 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVG+LYRHRLYIDWRRR +H++ H Sbjct: 254 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGDLYRHRLYIDWRRRPDHHHHH 304 >XP_003529866.2 PREDICTED: B3 domain-containing protein Os03g0120900-like [Glycine max] XP_006583192.1 PREDICTED: B3 domain-containing protein Os03g0120900-like [Glycine max] KRH47751.1 hypothetical protein GLYMA_07G048200 [Glycine max] KRH47752.1 hypothetical protein GLYMA_07G048200 [Glycine max] Length = 491 Score = 99.0 bits (245), Expect = 2e-22 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIHEYQYHH 105 SYVMTKGWSRFVKEKKLDAGD+VSFQRGVGELYRHRLYIDW RR +H++ H + H Sbjct: 192 SYVMTKGWSRFVKEKKLDAGDMVSFQRGVGELYRHRLYIDWWRRPDHHHHHHHGPDH 248 >KRH47753.1 hypothetical protein GLYMA_07G048200 [Glycine max] Length = 500 Score = 99.0 bits (245), Expect = 2e-22 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIHEYQYHH 105 SYVMTKGWSRFVKEKKLDAGD+VSFQRGVGELYRHRLYIDW RR +H++ H + H Sbjct: 201 SYVMTKGWSRFVKEKKLDAGDMVSFQRGVGELYRHRLYIDWWRRPDHHHHHHHGPDH 257 >KHN06382.1 B3 domain-containing protein [Glycine soja] Length = 527 Score = 99.0 bits (245), Expect = 3e-22 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIHEYQYHH 105 SYVMTKGWSRFVKEKKLDAGD+VSFQRGVGELYRHRLYIDW RR +H++ H + H Sbjct: 228 SYVMTKGWSRFVKEKKLDAGDMVSFQRGVGELYRHRLYIDWWRRPDHHHHHHHGPDH 284 >XP_017409735.1 PREDICTED: B3 domain-containing transcription factor NGA1 [Vigna angularis] XP_017409736.1 PREDICTED: B3 domain-containing transcription factor NGA1 [Vigna angularis] XP_017409737.1 PREDICTED: B3 domain-containing transcription factor NGA1 [Vigna angularis] XP_017409738.1 PREDICTED: B3 domain-containing transcription factor NGA1 [Vigna angularis] KOM29116.1 hypothetical protein LR48_Vigan635s004100 [Vigna angularis] BAT80377.1 hypothetical protein VIGAN_02338400 [Vigna angularis var. angularis] Length = 458 Score = 98.6 bits (244), Expect = 3e-22 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNN 129 SYVMTKGWSRFVKEKKLDAGDIVSFQRG+G++YRHRLYIDWRRRT+H + Sbjct: 180 SYVMTKGWSRFVKEKKLDAGDIVSFQRGLGDMYRHRLYIDWRRRTDHGH 228 >XP_003553806.1 PREDICTED: B3 domain-containing transcription factor NGA1-like [Glycine max] XP_006604926.1 PREDICTED: B3 domain-containing transcription factor NGA1-like [Glycine max] XP_014627637.1 PREDICTED: B3 domain-containing transcription factor NGA1-like [Glycine max] XP_014627638.1 PREDICTED: B3 domain-containing transcription factor NGA1-like [Glycine max] XP_014627639.1 PREDICTED: B3 domain-containing transcription factor NGA1-like [Glycine max] KHN11362.1 B3 domain-containing transcription factor NGA1 [Glycine soja] KRG97268.1 hypothetical protein GLYMA_19G261300 [Glycine max] KRG97269.1 hypothetical protein GLYMA_19G261300 [Glycine max] KRG97270.1 hypothetical protein GLYMA_19G261300 [Glycine max] KRG97271.1 hypothetical protein GLYMA_19G261300 [Glycine max] KRG97272.1 hypothetical protein GLYMA_19G261300 [Glycine max] Length = 413 Score = 98.2 bits (243), Expect = 3e-22 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNNIHEY 117 SYVMTKGWSRFVKEKKLDAGDIVSFQRG+G+LYRHRLYIDWR+R+ H + H + Sbjct: 151 SYVMTKGWSRFVKEKKLDAGDIVSFQRGLGDLYRHRLYIDWRKRSAHPHAHHH 203 >XP_014499090.1 PREDICTED: B3 domain-containing transcription factor NGA1 [Vigna radiata var. radiata] Length = 463 Score = 98.6 bits (244), Expect = 3e-22 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -3 Query: 275 SYVMTKGWSRFVKEKKLDAGDIVSFQRGVGELYRHRLYIDWRRRTNHNN 129 SYVMTKGWSRFVKEKKLDAGDIVSFQRG+G++YRHRLYIDWRRRT+H + Sbjct: 181 SYVMTKGWSRFVKEKKLDAGDIVSFQRGLGDMYRHRLYIDWRRRTDHGH 229