BLASTX nr result
ID: Glycyrrhiza28_contig00023584
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00023584 (344 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019413806.1 PREDICTED: 60S ribosomal protein L38-like [Lupinu... 67 2e-12 XP_015875766.1 PREDICTED: 60S ribosomal protein L38 [Ziziphus ju... 66 4e-12 XP_012085801.1 PREDICTED: 60S ribosomal protein L38 [Jatropha cu... 66 4e-12 XP_004302190.1 PREDICTED: 60S ribosomal protein L38 [Fragaria ve... 66 4e-12 XP_019418267.1 PREDICTED: 60S ribosomal protein L38-like [Lupinu... 65 8e-12 XP_019432679.1 PREDICTED: 60S ribosomal protein L38 [Lupinus ang... 65 8e-12 OIV95743.1 hypothetical protein TanjilG_05291 [Lupinus angustifo... 65 1e-11 XP_011007402.1 PREDICTED: 60S ribosomal protein L38-like [Populu... 65 1e-11 XP_004289816.1 PREDICTED: 60S ribosomal protein L38-like [Fragar... 65 1e-11 AEJ20976.1 60S ribosomal protein L38A [Caragana jubata] 65 1e-11 KDO45681.1 hypothetical protein CISIN_1g0352561mg, partial [Citr... 64 2e-11 WP_071414624.1 hypothetical protein [Acinetobacter baumannii] OI... 64 2e-11 XP_008793782.1 PREDICTED: 60S ribosomal protein L38 [Phoenix dac... 64 2e-11 XP_006428680.1 hypothetical protein CICLE_v10013279mg [Citrus cl... 64 2e-11 XP_007207316.1 hypothetical protein PRUPE_ppa014434mg [Prunus pe... 64 2e-11 XP_003631881.1 PREDICTED: 60S ribosomal protein L38 [Vitis vinif... 64 2e-11 EEF47361.1 60S ribosomal protein L38, putative [Ricinus communis] 64 2e-11 XP_003593868.1 60S ribosomal protein L38A [Medicago truncatula] ... 64 2e-11 XP_018504083.1 PREDICTED: 60S ribosomal protein L38-like [Pyrus ... 64 2e-11 EEF28545.1 60S ribosomal protein L38, putative [Ricinus communis] 64 3e-11 >XP_019413806.1 PREDICTED: 60S ribosomal protein L38-like [Lupinus angustifolius] OIV99444.1 hypothetical protein TanjilG_17254 [Lupinus angustifolius] Length = 69 Score = 66.6 bits (161), Expect = 2e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTLSVFD+EKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLSVFDTEKADKLKQSLPPGLTVQDL 69 >XP_015875766.1 PREDICTED: 60S ribosomal protein L38 [Ziziphus jujuba] Length = 69 Score = 65.9 bits (159), Expect = 4e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFDSEKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLTVQDL 69 >XP_012085801.1 PREDICTED: 60S ribosomal protein L38 [Jatropha curcas] KDP26900.1 hypothetical protein JCGZ_18058 [Jatropha curcas] Length = 69 Score = 65.9 bits (159), Expect = 4e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFDSEKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLTVQDL 69 >XP_004302190.1 PREDICTED: 60S ribosomal protein L38 [Fragaria vesca subsp. vesca] Length = 69 Score = 65.9 bits (159), Expect = 4e-12 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFDSEKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLTVQDL 69 >XP_019418267.1 PREDICTED: 60S ribosomal protein L38-like [Lupinus angustifolius] Length = 69 Score = 65.1 bits (157), Expect = 8e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTLSVFD+EKADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLSVFDTEKADKLKQSLPPGLSVQDL 69 >XP_019432679.1 PREDICTED: 60S ribosomal protein L38 [Lupinus angustifolius] OIW21292.1 hypothetical protein TanjilG_31621 [Lupinus angustifolius] Length = 69 Score = 65.1 bits (157), Expect = 8e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTLSVFD+EKADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLSVFDTEKADKLKQSLPPGLSVQDL 69 >OIV95743.1 hypothetical protein TanjilG_05291 [Lupinus angustifolius] Length = 76 Score = 65.1 bits (157), Expect = 1e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTLSVFD+EKADKLKQSLPPGL+VQDL Sbjct: 45 CSKYLYTLSVFDTEKADKLKQSLPPGLSVQDL 76 >XP_011007402.1 PREDICTED: 60S ribosomal protein L38-like [Populus euphratica] Length = 69 Score = 64.7 bits (156), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFD+EKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLCVFDTEKADKLKQSLPPGLTVQDL 69 >XP_004289816.1 PREDICTED: 60S ribosomal protein L38-like [Fragaria vesca subsp. vesca] Length = 69 Score = 64.7 bits (156), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFD+EKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLCVFDTEKADKLKQSLPPGLTVQDL 69 >AEJ20976.1 60S ribosomal protein L38A [Caragana jubata] Length = 69 Score = 64.7 bits (156), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFD+EKADKLKQSLPPGLTVQDL Sbjct: 38 CSKYLYTLCVFDTEKADKLKQSLPPGLTVQDL 69 >KDO45681.1 hypothetical protein CISIN_1g0352561mg, partial [Citrus sinensis] Length = 68 Score = 64.3 bits (155), Expect = 2e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFDSEKADKLKQSLPPGL+VQDL Sbjct: 37 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 68 >WP_071414624.1 hypothetical protein [Acinetobacter baumannii] OIC45660.1 hypothetical protein A7L55_20915 [Acinetobacter baumannii] Length = 69 Score = 64.3 bits (155), Expect = 2e-11 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 C KYLYTL VFDSEKADKLKQSLPPGLTVQDL Sbjct: 38 CKKYLYTLCVFDSEKADKLKQSLPPGLTVQDL 69 >XP_008793782.1 PREDICTED: 60S ribosomal protein L38 [Phoenix dactylifera] Length = 69 Score = 64.3 bits (155), Expect = 2e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFDSEKADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >XP_006428680.1 hypothetical protein CICLE_v10013279mg [Citrus clementina] XP_006442966.1 hypothetical protein CICLE_v10023214mg [Citrus clementina] XP_006442967.1 hypothetical protein CICLE_v10023214mg [Citrus clementina] XP_006478751.1 PREDICTED: 60S ribosomal protein L38 [Citrus sinensis] XP_006480494.1 PREDICTED: 60S ribosomal protein L38 [Citrus sinensis] XP_011649040.1 PREDICTED: 60S ribosomal protein L38-like [Cucumis sativus] XP_015935557.1 PREDICTED: 60S ribosomal protein L38 [Arachis duranensis] XP_016169189.1 PREDICTED: 60S ribosomal protein L38 [Arachis ipaensis] ESR41920.1 hypothetical protein CICLE_v10013279mg [Citrus clementina] ESR56206.1 hypothetical protein CICLE_v10023214mg [Citrus clementina] ESR56207.1 hypothetical protein CICLE_v10023214mg [Citrus clementina] KGN61359.1 hypothetical protein Csa_2G098440 [Cucumis sativus] Length = 69 Score = 64.3 bits (155), Expect = 2e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFDSEKADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >XP_007207316.1 hypothetical protein PRUPE_ppa014434mg [Prunus persica] XP_008218474.1 PREDICTED: 60S ribosomal protein L38 [Prunus mume] XP_008222531.1 PREDICTED: 60S ribosomal protein L38 [Prunus mume] ONI05243.1 hypothetical protein PRUPE_6G363900 [Prunus persica] ONI29323.1 hypothetical protein PRUPE_1G193400 [Prunus persica] Length = 69 Score = 64.3 bits (155), Expect = 2e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFDSEKADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >XP_003631881.1 PREDICTED: 60S ribosomal protein L38 [Vitis vinifera] XP_004145035.1 PREDICTED: 60S ribosomal protein L38 [Cucumis sativus] XP_008441729.1 PREDICTED: 60S ribosomal protein L38 [Cucumis melo] XP_008460031.1 PREDICTED: 60S ribosomal protein L38 [Cucumis melo] XP_008460032.1 PREDICTED: 60S ribosomal protein L38 [Cucumis melo] XP_010258506.1 PREDICTED: 60S ribosomal protein L38 [Nelumbo nucifera] XP_010242739.1 PREDICTED: 60S ribosomal protein L38 [Nelumbo nucifera] XP_010672261.1 PREDICTED: 60S ribosomal protein L38 [Beta vulgaris subsp. vulgaris] XP_010673886.1 PREDICTED: 60S ribosomal protein L38 [Beta vulgaris subsp. vulgaris] XP_011620720.1 PREDICTED: 60S ribosomal protein L38 [Amborella trichopoda] XP_011656729.1 PREDICTED: 60S ribosomal protein L38 [Cucumis sativus] XP_015583639.1 PREDICTED: 60S ribosomal protein L38 [Ricinus communis] XP_002514807.2 PREDICTED: 60S ribosomal protein L38 [Ricinus communis] KCW46089.1 hypothetical protein EUGRSUZ_K00006 [Eucalyptus grandis] KGN46309.1 hypothetical protein Csa_6G081500 [Cucumis sativus] KMT14714.1 hypothetical protein BVRB_4g074810 [Beta vulgaris subsp. vulgaris] KMT15805.1 hypothetical protein BVRB_3g057800 [Beta vulgaris subsp. vulgaris] OAY32247.1 hypothetical protein MANES_13G002900 [Manihot esculenta] OAY34206.1 hypothetical protein MANES_12G002500 [Manihot esculenta] OAY37743.1 hypothetical protein MANES_11G125700 [Manihot esculenta] Length = 69 Score = 64.3 bits (155), Expect = 2e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFDSEKADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 69 >EEF47361.1 60S ribosomal protein L38, putative [Ricinus communis] Length = 78 Score = 64.3 bits (155), Expect = 2e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFDSEKADKLKQSLPPGL+VQDL Sbjct: 47 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 78 >XP_003593868.1 60S ribosomal protein L38A [Medicago truncatula] AES64119.1 60S ribosomal protein L38A [Medicago truncatula] Length = 69 Score = 63.9 bits (154), Expect = 2e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTLSVFD EKADKLKQSLPPGL+VQDL Sbjct: 38 CSKYLYTLSVFDVEKADKLKQSLPPGLSVQDL 69 >XP_018504083.1 PREDICTED: 60S ribosomal protein L38-like [Pyrus x bretschneideri] XP_018499311.1 PREDICTED: 60S ribosomal protein L38-like [Pyrus x bretschneideri] Length = 69 Score = 63.9 bits (154), Expect = 2e-11 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFDSEKADKLKQSLPPGL VQDL Sbjct: 38 CSKYLYTLCVFDSEKADKLKQSLPPGLNVQDL 69 >EEF28545.1 60S ribosomal protein L38, putative [Ricinus communis] Length = 96 Score = 64.3 bits (155), Expect = 3e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 342 CSKYLYTLSVFDSEKADKLKQSLPPGLTVQDL 247 CSKYLYTL VFDSEKADKLKQSLPPGL+VQDL Sbjct: 65 CSKYLYTLCVFDSEKADKLKQSLPPGLSVQDL 96