BLASTX nr result
ID: Glycyrrhiza28_contig00023176
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00023176 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP73080.1 Sorting and assembly machinery component 50 isogeny [... 63 2e-09 XP_003519426.1 PREDICTED: sorting and assembly machinery compone... 63 2e-09 XP_006595856.1 PREDICTED: sorting and assembly machinery compone... 60 2e-08 XP_016166942.1 PREDICTED: uncharacterized protein LOC107609465 [... 60 2e-08 KYP56490.1 Sorting and assembly machinery component 50 isogeny [... 60 2e-08 XP_015973805.1 PREDICTED: uncharacterized protein LOC107496983 [... 60 2e-08 KHN48580.1 Sorting and assembly machinery component 50 like [Gly... 60 2e-08 XP_003544065.1 PREDICTED: sorting and assembly machinery compone... 60 2e-08 XP_019415319.1 PREDICTED: sorting and assembly machinery compone... 59 6e-08 XP_014494374.1 PREDICTED: sorting and assembly machinery compone... 58 1e-07 XP_017418983.1 PREDICTED: sorting and assembly machinery compone... 58 1e-07 XP_019417557.1 PREDICTED: sorting and assembly machinery compone... 58 2e-07 XP_019417556.1 PREDICTED: sorting and assembly machinery compone... 58 2e-07 XP_019417555.1 PREDICTED: sorting and assembly machinery compone... 58 2e-07 XP_007141745.1 hypothetical protein PHAVU_008G222000g [Phaseolus... 58 2e-07 XP_004491020.1 PREDICTED: uncharacterized protein LOC101512907 [... 57 2e-07 XP_003616676.2 outer membrane OMP85 family protein [Medicago tru... 57 4e-07 XP_007163568.1 hypothetical protein PHAVU_001G245000g [Phaseolus... 56 6e-07 KHN31295.1 Sorting and assembly machinery component 50 like B [G... 56 8e-07 KHN04777.1 Sorting and assembly machinery component 50 like A [G... 56 8e-07 >KYP73080.1 Sorting and assembly machinery component 50 isogeny [Cajanus cajan] Length = 423 Score = 63.2 bits (152), Expect = 2e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGNYFY+LRKDE+DRGKTGF+FSFSAPS Sbjct: 394 RLEGNYFYILRKDEHDRGKTGFRFSFSAPS 423 >XP_003519426.1 PREDICTED: sorting and assembly machinery component 50 homolog [Glycine max] KHN38529.1 Sorting and assembly machinery component 50 like [Glycine soja] KRH73273.1 hypothetical protein GLYMA_02G264000 [Glycine max] Length = 532 Score = 63.2 bits (152), Expect = 2e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGNYFY+LRKDE+DRGKTGF+FSFSAPS Sbjct: 503 RLEGNYFYILRKDEHDRGKTGFRFSFSAPS 532 >XP_006595856.1 PREDICTED: sorting and assembly machinery component 50 homolog isoform X2 [Glycine max] Length = 504 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGNYFY+LRK E+DRGKTGF+FSFSAPS Sbjct: 475 RLEGNYFYILRKGEHDRGKTGFRFSFSAPS 504 >XP_016166942.1 PREDICTED: uncharacterized protein LOC107609465 [Arachis ipaensis] Length = 526 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGNYFY+LRK E+DRGKTGF+FSFSAPS Sbjct: 497 RLEGNYFYILRKHEHDRGKTGFRFSFSAPS 526 >KYP56490.1 Sorting and assembly machinery component 50 isogeny [Cajanus cajan] Length = 527 Score = 60.5 bits (145), Expect = 2e-08 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGN++Y+LRKDE+DRGKTGF+FSFSAPS Sbjct: 498 RLEGNFYYILRKDEHDRGKTGFRFSFSAPS 527 >XP_015973805.1 PREDICTED: uncharacterized protein LOC107496983 [Arachis duranensis] Length = 528 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGNYFY+LRK E+DRGKTGF+FSFSAPS Sbjct: 499 RLEGNYFYILRKHEHDRGKTGFRFSFSAPS 528 >KHN48580.1 Sorting and assembly machinery component 50 like [Glycine soja] Length = 535 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGNYFY+LRK E+DRGKTGF+FSFSAPS Sbjct: 506 RLEGNYFYILRKGEHDRGKTGFRFSFSAPS 535 >XP_003544065.1 PREDICTED: sorting and assembly machinery component 50 homolog isoform X1 [Glycine max] KRH14921.1 hypothetical protein GLYMA_14G057500 [Glycine max] Length = 535 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGNYFY+LRK E+DRGKTGF+FSFSAPS Sbjct: 506 RLEGNYFYILRKGEHDRGKTGFRFSFSAPS 535 >XP_019415319.1 PREDICTED: sorting and assembly machinery component 50 homolog B-like [Lupinus angustifolius] OIV98411.1 hypothetical protein TanjilG_16738 [Lupinus angustifolius] Length = 536 Score = 58.9 bits (141), Expect = 6e-08 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGN++Y+LR+DE+DRGKTGF+FSFSAPS Sbjct: 507 RLEGNFYYILRQDEHDRGKTGFRFSFSAPS 536 >XP_014494374.1 PREDICTED: sorting and assembly machinery component 50 homolog [Vigna radiata var. radiata] Length = 534 Score = 58.2 bits (139), Expect = 1e-07 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGN+++VL++DEYDRGKTGF+FSFSAPS Sbjct: 505 RLEGNFYHVLKQDEYDRGKTGFRFSFSAPS 534 >XP_017418983.1 PREDICTED: sorting and assembly machinery component 50 homolog [Vigna angularis] KOM39612.1 hypothetical protein LR48_Vigan03g299400 [Vigna angularis] BAT86457.1 hypothetical protein VIGAN_04411100 [Vigna angularis var. angularis] Length = 534 Score = 58.2 bits (139), Expect = 1e-07 Identities = 24/30 (80%), Positives = 30/30 (100%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGN+++VL++DEYDRGKTGF+FSFSAPS Sbjct: 505 RLEGNFYHVLKQDEYDRGKTGFRFSFSAPS 534 >XP_019417557.1 PREDICTED: sorting and assembly machinery component 50 homolog isoform X3 [Lupinus angustifolius] Length = 521 Score = 57.8 bits (138), Expect = 2e-07 Identities = 23/30 (76%), Positives = 30/30 (100%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGN++Y+L++DE+DRGKTGF+FSFSAPS Sbjct: 492 RLEGNFYYILKQDEHDRGKTGFRFSFSAPS 521 >XP_019417556.1 PREDICTED: sorting and assembly machinery component 50 homolog isoform X2 [Lupinus angustifolius] Length = 522 Score = 57.8 bits (138), Expect = 2e-07 Identities = 23/30 (76%), Positives = 30/30 (100%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGN++Y+L++DE+DRGKTGF+FSFSAPS Sbjct: 493 RLEGNFYYILKQDEHDRGKTGFRFSFSAPS 522 >XP_019417555.1 PREDICTED: sorting and assembly machinery component 50 homolog isoform X1 [Lupinus angustifolius] OIV97430.1 hypothetical protein TanjilG_16191 [Lupinus angustifolius] Length = 532 Score = 57.8 bits (138), Expect = 2e-07 Identities = 23/30 (76%), Positives = 30/30 (100%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGN++Y+L++DE+DRGKTGF+FSFSAPS Sbjct: 503 RLEGNFYYILKQDEHDRGKTGFRFSFSAPS 532 >XP_007141745.1 hypothetical protein PHAVU_008G222000g [Phaseolus vulgaris] ESW13739.1 hypothetical protein PHAVU_008G222000g [Phaseolus vulgaris] Length = 537 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAP 87 RLEGNYFY+LRK E DRGKTGF+FSFSAP Sbjct: 508 RLEGNYFYILRKGEQDRGKTGFRFSFSAP 536 >XP_004491020.1 PREDICTED: uncharacterized protein LOC101512907 [Cicer arietinum] Length = 542 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGNY +VLRKDE+DRGK GF+FSFSAPS Sbjct: 513 RLEGNYLHVLRKDEHDRGKAGFRFSFSAPS 542 >XP_003616676.2 outer membrane OMP85 family protein [Medicago truncatula] AES99634.2 outer membrane OMP85 family protein [Medicago truncatula] Length = 520 Score = 56.6 bits (135), Expect = 4e-07 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAP 87 RLE NYF++LRKDE+D GKTGFKFSFSAP Sbjct: 489 RLEANYFHILRKDEHDNGKTGFKFSFSAP 517 >XP_007163568.1 hypothetical protein PHAVU_001G245000g [Phaseolus vulgaris] ESW35562.1 hypothetical protein PHAVU_001G245000g [Phaseolus vulgaris] Length = 534 Score = 56.2 bits (134), Expect = 6e-07 Identities = 23/30 (76%), Positives = 30/30 (100%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGN++YVL+++E+DRGKTGF+FSFSAPS Sbjct: 505 RLEGNFYYVLKQNEHDRGKTGFRFSFSAPS 534 >KHN31295.1 Sorting and assembly machinery component 50 like B [Glycine soja] Length = 500 Score = 55.8 bits (133), Expect = 8e-07 Identities = 22/30 (73%), Positives = 30/30 (100%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGN++Y+L+++E+DRGKTGF+FSFSAPS Sbjct: 471 RLEGNFYYILKQNEHDRGKTGFRFSFSAPS 500 >KHN04777.1 Sorting and assembly machinery component 50 like A [Glycine soja] Length = 506 Score = 55.8 bits (133), Expect = 8e-07 Identities = 22/30 (73%), Positives = 30/30 (100%) Frame = +1 Query: 1 RLEGNYFYVLRKDEYDRGKTGFKFSFSAPS 90 RLEGN++Y+L+++E+DRGKTGF+FSFSAPS Sbjct: 477 RLEGNFYYILKQNEHDRGKTGFRFSFSAPS 506