BLASTX nr result
ID: Glycyrrhiza28_contig00023090
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00023090 (235 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_029879138.1 MULTISPECIES: biphenyl 2,3-dioxygenase [Bradyrhiz... 149 2e-42 WP_050627582.1 biphenyl 2,3-dioxygenase [Bradyrhizobium viridifu... 149 2e-42 WP_048463551.1 biphenyl 2,3-dioxygenase [Methylobacterium aquati... 114 5e-29 WP_048465155.1 biphenyl 2,3-dioxygenase [Methylobacterium aquati... 114 5e-29 WP_048879838.1 biphenyl 2,3-dioxygenase [Acidocella aminolytica]... 107 3e-26 WP_027541278.1 biphenyl 2,3-dioxygenase [Bradyrhizobium sp. URHA... 105 2e-25 ETR78703.1 biphenyl 2,3-dioxygenase [Afipia sp. P52-10] 103 4e-25 WP_034467141.1 biphenyl 2,3-dioxygenase [Afipia sp. P52-10] 103 4e-25 CUT15270.1 Biphenyl23diol 12dioxygenase EC 1131139 [Bradyrhizobi... 97 7e-25 WP_073138374.1 biphenyl 2,3-dioxygenase [Roseomonas rosea] SHK11... 102 1e-24 WP_012112949.1 biphenyl 2,3-dioxygenase [Xanthobacter autotrophi... 102 2e-24 WP_009026907.1 biphenyl 2,3-dioxygenase [Bradyrhizobium sp. ORS ... 102 2e-24 WP_015669274.1 biphenyl-2,3-diol 1,2-dioxygenase [Bradyrhizobium... 101 5e-24 KTS82152.1 biphenyl 2,3-dioxygenase, partial [Pantoea dispersa] 97 6e-24 SFJ98326.1 2,3-dihydroxybiphenyl 1,2-dioxygenase [Bradyrhizobium... 100 9e-24 WP_012029590.1 biphenyl 2,3-dioxygenase [Bradyrhizobium sp. ORS ... 100 9e-24 ERF81974.1 2,3-dihydroxybiphenyl 1,2-dioxygenase [Bradyrhizobium... 100 9e-24 WP_029005267.1 biphenyl 2,3-dioxygenase [Azorhizobium doebereine... 100 1e-23 WP_008962485.1 biphenyl 2,3-dioxygenase [Bradyrhizobium sp. STM ... 100 1e-23 WP_024280102.1 biphenyl 2,3-dioxygenase [Xanthobacter sp. 126] 100 2e-23 >WP_029879138.1 MULTISPECIES: biphenyl 2,3-dioxygenase [Bradyrhizobium] KIU45956.1 biphenyl 2,3-dioxygenase [Bradyrhizobium elkanii] OCX27013.1 biphenyl 2,3-dioxygenase [Bradyrhizobium sp. UASWS1016] Length = 332 Score = 149 bits (376), Expect = 2e-42 Identities = 69/70 (98%), Positives = 69/70 (98%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVPDCPWLDAV 37 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVPDCPWLDAV Sbjct: 263 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVPDCPWLDAV 322 Query: 36 TGRGTSI*KT 7 TGRGTSI KT Sbjct: 323 TGRGTSIQKT 332 >WP_050627582.1 biphenyl 2,3-dioxygenase [Bradyrhizobium viridifuturi] Length = 332 Score = 149 bits (375), Expect = 2e-42 Identities = 68/70 (97%), Positives = 69/70 (98%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVPDCPWLDAV 37 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVPDCPWLDAV Sbjct: 263 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVPDCPWLDAV 322 Query: 36 TGRGTSI*KT 7 TGRGTS+ KT Sbjct: 323 TGRGTSVQKT 332 >WP_048463551.1 biphenyl 2,3-dioxygenase [Methylobacterium aquaticum] KMO36563.1 biphenyl 2,3-dioxygenase [Methylobacterium aquaticum] Length = 326 Score = 114 bits (285), Expect = 5e-29 Identities = 53/65 (81%), Positives = 57/65 (87%), Gaps = 2/65 (3%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAP--VPDCPWLD 43 R I+PATW+ HET DGPSFWGH+RLYMEPE RARLREMRLSAAARGVRAP VP+CPWLD Sbjct: 261 REIEPATWEAHETHDGPSFWGHERLYMEPEQRARLREMRLSAAARGVRAPIDVPNCPWLD 320 Query: 42 AVTGR 28 AV R Sbjct: 321 AVIAR 325 >WP_048465155.1 biphenyl 2,3-dioxygenase [Methylobacterium aquaticum] KMO32222.1 biphenyl 2,3-dioxygenase [Methylobacterium aquaticum] Length = 326 Score = 114 bits (285), Expect = 5e-29 Identities = 53/65 (81%), Positives = 57/65 (87%), Gaps = 2/65 (3%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAP--VPDCPWLD 43 R I+PATW+ HET DGPSFWGH+RLYMEPE RARLREMRLSAAARGVRAP VP+CPWLD Sbjct: 261 REIEPATWEAHETHDGPSFWGHERLYMEPEQRARLREMRLSAAARGVRAPVNVPNCPWLD 320 Query: 42 AVTGR 28 AV R Sbjct: 321 AVIAR 325 >WP_048879838.1 biphenyl 2,3-dioxygenase [Acidocella aminolytica] GAN81448.1 biphenyl-2,3-diol 1,2-dioxygenase [Acidocella aminolytica 101 = DSM 11237] SHF01719.1 2,3-dihydroxybiphenyl 1,2-dioxygenase [Acidocella aminolytica 101 = DSM 11237] Length = 328 Score = 107 bits (266), Expect = 3e-26 Identities = 47/66 (71%), Positives = 53/66 (80%), Gaps = 2/66 (3%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPV--PDCPWLD 43 R++DPATWQ HETFDGPS WGH+RLY+E RARLREMRLSAAARG+RAPV PDCPW Sbjct: 263 RIVDPATWQSHETFDGPSLWGHERLYLEEAPRARLREMRLSAAARGIRAPVVLPDCPWAQ 322 Query: 42 AVTGRG 25 + G Sbjct: 323 EILAAG 328 >WP_027541278.1 biphenyl 2,3-dioxygenase [Bradyrhizobium sp. URHA0002] Length = 324 Score = 105 bits (261), Expect = 2e-25 Identities = 47/65 (72%), Positives = 55/65 (84%), Gaps = 2/65 (3%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVP--DCPWLD 43 R+IDPATWQPHETFDGPSFWGH+R+++ E R RLR+MRLSAAARGVRAP+P +C WLD Sbjct: 259 RLIDPATWQPHETFDGPSFWGHERIHLPEEQRKRLRDMRLSAAARGVRAPLPMENCAWLD 318 Query: 42 AVTGR 28 V R Sbjct: 319 FVISR 323 >ETR78703.1 biphenyl 2,3-dioxygenase [Afipia sp. P52-10] Length = 319 Score = 103 bits (258), Expect = 4e-25 Identities = 44/64 (68%), Positives = 55/64 (85%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVPDCPWLDAV 37 RVIDP TWQPHETFDGPSFWGH+R + P+ R+++R++RL AAARG+RAPV +C W +AV Sbjct: 257 RVIDPNTWQPHETFDGPSFWGHERFNLPPDQRSQMRQLRLDAAARGIRAPV-NCAWFEAV 315 Query: 36 TGRG 25 TGRG Sbjct: 316 TGRG 319 >WP_034467141.1 biphenyl 2,3-dioxygenase [Afipia sp. P52-10] Length = 329 Score = 103 bits (258), Expect = 4e-25 Identities = 44/64 (68%), Positives = 55/64 (85%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVPDCPWLDAV 37 RVIDP TWQPHETFDGPSFWGH+R + P+ R+++R++RL AAARG+RAPV +C W +AV Sbjct: 267 RVIDPNTWQPHETFDGPSFWGHERFNLPPDQRSQMRQLRLDAAARGIRAPV-NCAWFEAV 325 Query: 36 TGRG 25 TGRG Sbjct: 326 TGRG 329 >CUT15270.1 Biphenyl23diol 12dioxygenase EC 1131139 [Bradyrhizobium sp.] Length = 89 Score = 97.4 bits (241), Expect = 7e-25 Identities = 45/68 (66%), Positives = 50/68 (73%), Gaps = 5/68 (7%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVP-----DCP 52 RVIDP TWQPHETFDGPS WGH+RLYM E R RLR+MRL AA+RGVR P +C Sbjct: 21 RVIDPETWQPHETFDGPSLWGHERLYMPEEQRKRLRDMRLDAASRGVRVADPRVPPLNCA 80 Query: 51 WLDAVTGR 28 WLD+V R Sbjct: 81 WLDSVVAR 88 >WP_073138374.1 biphenyl 2,3-dioxygenase [Roseomonas rosea] SHK11132.1 2,3-dihydroxybiphenyl 1,2-dioxygenase [Roseomonas rosea] Length = 325 Score = 102 bits (255), Expect = 1e-24 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 3/66 (4%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPES-RARLREMRLSAAARGVRAPV--PDCPWL 46 R+IDPATWQPHET DGPS WGHDRLY PE+ RA+LREMRLSAAARGVR P+ P+C WL Sbjct: 259 RIIDPATWQPHETTDGPSLWGHDRLYDMPEAQRAKLREMRLSAAARGVRVPMPAPNCAWL 318 Query: 45 DAVTGR 28 DAV + Sbjct: 319 DAVVAQ 324 >WP_012112949.1 biphenyl 2,3-dioxygenase [Xanthobacter autotrophicus] ABS66180.1 Glyoxalase/bleomycin resistance protein/dioxygenase [Xanthobacter autotrophicus Py2] Length = 322 Score = 102 bits (254), Expect = 2e-24 Identities = 46/58 (79%), Positives = 52/58 (89%), Gaps = 1/58 (1%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAP-VPDCPWL 46 RVIDPATW+PHETF GPSFWGH+RLY+ E RARLR+MRL+AAARG+RAP V DCPWL Sbjct: 259 RVIDPATWEPHETFAGPSFWGHERLYLPEEPRARLRDMRLAAAARGLRAPEVVDCPWL 316 >WP_009026907.1 biphenyl 2,3-dioxygenase [Bradyrhizobium sp. ORS 375] CCD91904.1 putative Biphenyl-2,3-diol 1,2-dioxygenase (23OHBP oxygenase) (2,3-dihydroxybiphenyl dioxygenase) (DHBD) [Bradyrhizobium sp. ORS 375] Length = 327 Score = 102 bits (253), Expect = 2e-24 Identities = 47/65 (72%), Positives = 52/65 (80%), Gaps = 5/65 (7%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVP-----DCP 52 RVIDPATWQPHETFDGPS WGH+RLY+ E R R+R+MRLSAAARGVR P P +C Sbjct: 259 RVIDPATWQPHETFDGPSLWGHERLYLPDEPRKRMRDMRLSAAARGVRVPDPRVPPLNCA 318 Query: 51 WLDAV 37 WLDAV Sbjct: 319 WLDAV 323 >WP_015669274.1 biphenyl-2,3-diol 1,2-dioxygenase [Bradyrhizobium oligotrophicum] BAM92190.1 putative biphenyl-2,3-diol 1,2-dioxygenase [Bradyrhizobium oligotrophicum S58] Length = 327 Score = 101 bits (251), Expect = 5e-24 Identities = 47/65 (72%), Positives = 51/65 (78%), Gaps = 5/65 (7%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVP-----DCP 52 RVIDP TWQPHETFDGPS WGH+RLY+ E R RLR+MRLSAAARGVR P P +C Sbjct: 259 RVIDPTTWQPHETFDGPSLWGHERLYLPDEPRKRLRDMRLSAAARGVRVPDPNVPPLNCA 318 Query: 51 WLDAV 37 WLDAV Sbjct: 319 WLDAV 323 >KTS82152.1 biphenyl 2,3-dioxygenase, partial [Pantoea dispersa] Length = 155 Score = 97.1 bits (240), Expect = 6e-24 Identities = 45/68 (66%), Positives = 49/68 (72%), Gaps = 5/68 (7%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVP-----DCP 52 RVIDP TWQPHETFDGPS WGH+RL M E R RLR+MR+ AA RGVR P P +C Sbjct: 87 RVIDPVTWQPHETFDGPSLWGHERLSMPDEQRKRLRDMRIDAAQRGVRVPDPVVPPLNCA 146 Query: 51 WLDAVTGR 28 WLDAV R Sbjct: 147 WLDAVVAR 154 >SFJ98326.1 2,3-dihydroxybiphenyl 1,2-dioxygenase [Bradyrhizobium sp. Gha] Length = 327 Score = 100 bits (249), Expect = 9e-24 Identities = 47/68 (69%), Positives = 51/68 (75%), Gaps = 5/68 (7%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVP-----DCP 52 RVIDPATWQPHETFDGPS WGH+RL M E R RLREMR+ AAARGVR P P +C Sbjct: 259 RVIDPATWQPHETFDGPSLWGHERLNMPEEQRKRLREMRMDAAARGVRVPDPRVPPLNCA 318 Query: 51 WLDAVTGR 28 WLD+V R Sbjct: 319 WLDSVVAR 326 >WP_012029590.1 biphenyl 2,3-dioxygenase [Bradyrhizobium sp. ORS 278] CAL79696.1 putative Biphenyl-2,3-diol 1,2-dioxygenase (23OHBP oxygenase) (2,3-dihydroxybiphenyl dioxygenase) (DHBD) [Bradyrhizobium sp. ORS 278] Length = 327 Score = 100 bits (249), Expect = 9e-24 Identities = 46/65 (70%), Positives = 52/65 (80%), Gaps = 5/65 (7%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVP-----DCP 52 RVIDPA+WQPHETFDGPS WGH+RLY+ E R R+R+MRLSAAARGVR P P +C Sbjct: 259 RVIDPASWQPHETFDGPSLWGHERLYLPDEPRKRMRDMRLSAAARGVRVPDPRVPPLNCA 318 Query: 51 WLDAV 37 WLDAV Sbjct: 319 WLDAV 323 >ERF81974.1 2,3-dihydroxybiphenyl 1,2-dioxygenase [Bradyrhizobium sp. DFCI-1] Length = 327 Score = 100 bits (249), Expect = 9e-24 Identities = 46/68 (67%), Positives = 50/68 (73%), Gaps = 5/68 (7%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVP-----DCP 52 RVIDP TWQPHETFDGPS WGH+RLYM E R RLR+MR+ AA RGVR P P +C Sbjct: 259 RVIDPVTWQPHETFDGPSLWGHERLYMPDEQRKRLRDMRIDAAQRGVRVPDPVVPPLNCA 318 Query: 51 WLDAVTGR 28 WLDAV R Sbjct: 319 WLDAVVAR 326 >WP_029005267.1 biphenyl 2,3-dioxygenase [Azorhizobium doebereinerae] Length = 322 Score = 100 bits (248), Expect = 1e-23 Identities = 44/58 (75%), Positives = 50/58 (86%), Gaps = 1/58 (1%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAP-VPDCPWL 46 R+IDPATW+PHETF GPSFWGH+RLY+ E RARLR+MRL AAA G+RAP V DCPWL Sbjct: 259 RLIDPATWEPHETFAGPSFWGHERLYLPEEPRARLRQMRLDAAAHGIRAPAVADCPWL 316 >WP_008962485.1 biphenyl 2,3-dioxygenase [Bradyrhizobium sp. STM 3809] CCD99895.1 putative Biphenyl-2,3-diol 1,2-dioxygenase (23OHBP oxygenase) (2,3-dihydroxybiphenyl dioxygenase) (DHBD) [Bradyrhizobium sp. STM 3809] Length = 327 Score = 100 bits (248), Expect = 1e-23 Identities = 46/65 (70%), Positives = 52/65 (80%), Gaps = 5/65 (7%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAPVP-----DCP 52 RVIDPATWQPHETFDGPS WGH+RL++ E R R+R+MRLSAAARGVR P P +C Sbjct: 259 RVIDPATWQPHETFDGPSLWGHERLHLPDEPRKRMRDMRLSAAARGVRVPDPRVPPLNCA 318 Query: 51 WLDAV 37 WLDAV Sbjct: 319 WLDAV 323 >WP_024280102.1 biphenyl 2,3-dioxygenase [Xanthobacter sp. 126] Length = 322 Score = 99.8 bits (247), Expect = 2e-23 Identities = 44/58 (75%), Positives = 52/58 (89%), Gaps = 1/58 (1%) Frame = -2 Query: 216 RVIDPATWQPHETFDGPSFWGHDRLYMEPESRARLREMRLSAAARGVRAP-VPDCPWL 46 RVIDPATW+PHETF GPSFWGH+RLY+ E RARLR+MRL+AAA+G+R+P V DCPWL Sbjct: 259 RVIDPATWEPHETFAGPSFWGHERLYLPEEPRARLRKMRLAAAAKGLRSPDVVDCPWL 316