BLASTX nr result
ID: Glycyrrhiza28_contig00023084
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00023084 (257 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN42126.1 Pentatricopeptide repeat-containing protein, mitochon... 140 5e-39 KHN15617.1 Pentatricopeptide repeat-containing protein, mitochon... 139 1e-38 KYP32046.1 hypothetical protein KK1_047371 [Cajanus cajan] 142 1e-38 XP_003521848.2 PREDICTED: pentatricopeptide repeat-containing pr... 142 2e-38 XP_012572900.1 PREDICTED: pentatricopeptide repeat-containing pr... 139 2e-38 KOM25405.1 hypothetical protein LR48_Vigan102s006300 [Vigna angu... 138 4e-38 XP_017405484.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 4e-38 KHN19321.1 Pentatricopeptide repeat-containing protein, mitochon... 138 8e-38 XP_007163815.1 hypothetical protein PHAVU_001G266700g, partial [... 140 1e-37 XP_003545811.1 PREDICTED: pentatricopeptide repeat-containing pr... 139 2e-37 OIW18999.1 hypothetical protein TanjilG_20272 [Lupinus angustifo... 135 4e-37 XP_013456828.1 PPR containing plant-like protein [Medicago trunc... 133 7e-37 XP_014521687.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 8e-37 KOM56331.1 hypothetical protein LR48_Vigan10g222300 [Vigna angul... 134 3e-36 XP_016192937.1 PREDICTED: pentatricopeptide repeat-containing pr... 136 3e-36 XP_019447262.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 9e-36 XP_015970154.1 PREDICTED: pentatricopeptide repeat-containing pr... 134 2e-35 XP_017440189.1 PREDICTED: pentatricopeptide repeat-containing pr... 134 3e-35 XP_014519140.1 PREDICTED: pentatricopeptide repeat-containing pr... 134 3e-35 XP_003605068.1 PPR containing plant-like protein [Medicago trunc... 132 1e-34 >KHN42126.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 337 Score = 140 bits (354), Expect = 5e-39 Identities = 67/74 (90%), Positives = 71/74 (95%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 V+WRTLLGACSVHNNVEIGQRVT KILEMERGHGGDYVLMSNI +GVGRFKDAE+LRE+I Sbjct: 264 VMWRTLLGACSVHNNVEIGQRVTNKILEMERGHGGDYVLMSNILVGVGRFKDAEKLREMI 323 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYS V Sbjct: 324 DKRIAFKLPGYSFV 337 >KHN15617.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 337 Score = 139 bits (351), Expect = 1e-38 Identities = 66/74 (89%), Positives = 71/74 (95%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 V+WRTLLGAC+VHNNVEIGQRVT KILEMERGHGGDYVLMSNI +GVGRFKDAE+LRE+I Sbjct: 264 VMWRTLLGACNVHNNVEIGQRVTNKILEMERGHGGDYVLMSNILVGVGRFKDAEKLREMI 323 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYS V Sbjct: 324 DKRIAFKLPGYSFV 337 >KYP32046.1 hypothetical protein KK1_047371 [Cajanus cajan] Length = 500 Score = 142 bits (359), Expect = 1e-38 Identities = 68/74 (91%), Positives = 72/74 (97%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 V+WRTLLG+CSVHNNVEIGQRVT KILEMERGHGGDYVLMSNI +GVGRFKDAERLRE+I Sbjct: 427 VMWRTLLGSCSVHNNVEIGQRVTRKILEMERGHGGDYVLMSNILVGVGRFKDAERLREMI 486 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYSLV Sbjct: 487 DKRIAFKLPGYSLV 500 >XP_003521848.2 PREDICTED: pentatricopeptide repeat-containing protein At1g09220, mitochondrial-like [Glycine max] KRH64860.1 hypothetical protein GLYMA_03G001300 [Glycine max] Length = 517 Score = 142 bits (359), Expect = 2e-38 Identities = 68/74 (91%), Positives = 71/74 (95%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 V+WRTLLGACSVHNNVEIGQRVT KILEMERGHGGDYVLMSNI +GVGRFKDAERLRE+I Sbjct: 444 VMWRTLLGACSVHNNVEIGQRVTNKILEMERGHGGDYVLMSNILVGVGRFKDAERLREVI 503 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYS V Sbjct: 504 DKRIAFKLPGYSFV 517 >XP_012572900.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09220, mitochondrial [Cicer arietinum] Length = 337 Score = 139 bits (350), Expect = 2e-38 Identities = 68/74 (91%), Positives = 69/74 (93%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 VIWRTLLGACSVHNNVEIGQRVT KILEMERGHGGDYVLMSNIF VGRFKD ERLRE+I Sbjct: 264 VIWRTLLGACSVHNNVEIGQRVTEKILEMERGHGGDYVLMSNIFASVGRFKDVERLREMI 323 Query: 181 DKRIAFKLPGYSLV 222 DKR AFKLPGYSLV Sbjct: 324 DKRNAFKLPGYSLV 337 >KOM25405.1 hypothetical protein LR48_Vigan102s006300 [Vigna angularis] Length = 337 Score = 138 bits (348), Expect = 4e-38 Identities = 64/74 (86%), Positives = 71/74 (95%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 V+WRTLLGACSVHNNVEIGQRVT K+LEMERGHGGDYVLMSNI +GVGRFKD +RLR++I Sbjct: 264 VMWRTLLGACSVHNNVEIGQRVTRKVLEMERGHGGDYVLMSNILVGVGRFKDPQRLRDMI 323 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYS+V Sbjct: 324 DKRIAFKLPGYSIV 337 >XP_017405484.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09220, mitochondrial-like [Vigna angularis] Length = 346 Score = 138 bits (348), Expect = 4e-38 Identities = 64/74 (86%), Positives = 71/74 (95%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 V+WRTLLGACSVHNNVEIGQRVT K+LEMERGHGGDYVLMSNI +GVGRFKD +RLR++I Sbjct: 273 VMWRTLLGACSVHNNVEIGQRVTRKVLEMERGHGGDYVLMSNILVGVGRFKDPQRLRDMI 332 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYS+V Sbjct: 333 DKRIAFKLPGYSIV 346 >KHN19321.1 Pentatricopeptide repeat-containing protein, mitochondrial, partial [Glycine soja] Length = 359 Score = 138 bits (347), Expect = 8e-38 Identities = 65/72 (90%), Positives = 70/72 (97%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 V+WRTLLGAC+VHNNVEIGQRVT KILEMERGHGGDYVLMSNI +GVGRFKDAE+LRE+I Sbjct: 286 VMWRTLLGACNVHNNVEIGQRVTNKILEMERGHGGDYVLMSNILVGVGRFKDAEKLREMI 345 Query: 181 DKRIAFKLPGYS 216 DKRIAFKLPGYS Sbjct: 346 DKRIAFKLPGYS 357 >XP_007163815.1 hypothetical protein PHAVU_001G266700g, partial [Phaseolus vulgaris] ESW35809.1 hypothetical protein PHAVU_001G266700g, partial [Phaseolus vulgaris] Length = 506 Score = 140 bits (353), Expect = 1e-37 Identities = 65/74 (87%), Positives = 72/74 (97%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 V+WRTLLGACSVHNNVEIGQRVT KILEMERGHGGDYVLMSNI +GVGRFKDA+RLR++I Sbjct: 433 VMWRTLLGACSVHNNVEIGQRVTRKILEMERGHGGDYVLMSNILVGVGRFKDAQRLRDMI 492 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYS++ Sbjct: 493 DKRIAFKLPGYSII 506 >XP_003545811.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09220, mitochondrial-like [Glycine max] XP_006598075.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09220, mitochondrial-like [Glycine max] KRH13288.1 hypothetical protein GLYMA_15G228600 [Glycine max] KRH13289.1 hypothetical protein GLYMA_15G228600 [Glycine max] KRH13290.1 hypothetical protein GLYMA_15G228600 [Glycine max] KRH13291.1 hypothetical protein GLYMA_15G228600 [Glycine max] Length = 517 Score = 139 bits (351), Expect = 2e-37 Identities = 66/74 (89%), Positives = 71/74 (95%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 V+WRTLLGAC+VHNNVEIGQRVT KILEMERGHGGDYVLMSNI +GVGRFKDAE+LRE+I Sbjct: 444 VMWRTLLGACNVHNNVEIGQRVTNKILEMERGHGGDYVLMSNILVGVGRFKDAEKLREMI 503 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYS V Sbjct: 504 DKRIAFKLPGYSFV 517 >OIW18999.1 hypothetical protein TanjilG_20272 [Lupinus angustifolius] Length = 320 Score = 135 bits (340), Expect = 4e-37 Identities = 62/74 (83%), Positives = 70/74 (94%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 VIWRTL+GAC+V+NNVEIGQRVT K+LEMERGHGGDYVLMSNI GVGRFKDAER+RE++ Sbjct: 247 VIWRTLIGACNVYNNVEIGQRVTKKVLEMERGHGGDYVLMSNILTGVGRFKDAERIREVL 306 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYS + Sbjct: 307 DKRIAFKLPGYSFL 320 >XP_013456828.1 PPR containing plant-like protein [Medicago truncatula] KEH30859.1 PPR containing plant-like protein [Medicago truncatula] Length = 272 Score = 133 bits (335), Expect = 7e-37 Identities = 65/74 (87%), Positives = 68/74 (91%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 VIWR LLGACSVH+NVEIGQRVT KILEME+GHGGDYVLMSNIF GVGRFKD ERLRE+I Sbjct: 199 VIWRVLLGACSVHDNVEIGQRVTKKILEMEKGHGGDYVLMSNIFAGVGRFKDVERLREMI 258 Query: 181 DKRIAFKLPGYSLV 222 DKR AFKL GYSLV Sbjct: 259 DKRNAFKLSGYSLV 272 >XP_014521687.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09220, mitochondrial-like [Vigna radiata var. radiata] Length = 510 Score = 138 bits (347), Expect = 8e-37 Identities = 64/74 (86%), Positives = 71/74 (95%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 V+WRTLLGACSVHNNVEIGQRVT K+LEMERGHGGDYVLMSNI + VGRFKDA+RLR++I Sbjct: 437 VMWRTLLGACSVHNNVEIGQRVTRKVLEMERGHGGDYVLMSNILVSVGRFKDAQRLRDMI 496 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYS+V Sbjct: 497 DKRIAFKLPGYSIV 510 >KOM56331.1 hypothetical protein LR48_Vigan10g222300 [Vigna angularis] Length = 346 Score = 134 bits (336), Expect = 3e-36 Identities = 62/74 (83%), Positives = 70/74 (94%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 V+WRTLLGACSVHNNV+IGQRV K+LEMERGHGGDYVLMSNI +GV RFKDA+RLR++I Sbjct: 273 VMWRTLLGACSVHNNVDIGQRVIRKVLEMERGHGGDYVLMSNILVGVERFKDAQRLRDMI 332 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYS+V Sbjct: 333 DKRIAFKLPGYSIV 346 >XP_016192937.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09220, mitochondrial [Arachis ipaensis] Length = 512 Score = 136 bits (343), Expect = 3e-36 Identities = 66/74 (89%), Positives = 69/74 (93%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 VIWRTLLGACSVHNNVEIGQRVT KILEMER HGGDYVLMSNIF+ VGRF DAERLRE+I Sbjct: 439 VIWRTLLGACSVHNNVEIGQRVTRKILEMERRHGGDYVLMSNIFVCVGRFNDAERLREMI 498 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFK+PGYS V Sbjct: 499 DKRIAFKIPGYSFV 512 >XP_019447262.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09220, mitochondrial [Lupinus angustifolius] Length = 515 Score = 135 bits (340), Expect = 9e-36 Identities = 62/74 (83%), Positives = 70/74 (94%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 VIWRTL+GAC+V+NNVEIGQRVT K+LEMERGHGGDYVLMSNI GVGRFKDAER+RE++ Sbjct: 442 VIWRTLIGACNVYNNVEIGQRVTKKVLEMERGHGGDYVLMSNILTGVGRFKDAERIREVL 501 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYS + Sbjct: 502 DKRIAFKLPGYSFL 515 >XP_015970154.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09220, mitochondrial [Arachis duranensis] Length = 512 Score = 134 bits (338), Expect = 2e-35 Identities = 65/74 (87%), Positives = 69/74 (93%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 VIWRTLLGACSVHNNVEIGQRVT KILEME+ HGGDYVLMSNIF+ VGRF DAERLRE+I Sbjct: 439 VIWRTLLGACSVHNNVEIGQRVTRKILEMEKRHGGDYVLMSNIFVCVGRFNDAERLREMI 498 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFK+PGYS V Sbjct: 499 DKRIAFKIPGYSSV 512 >XP_017440189.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09220, mitochondrial-like [Vigna angularis] XP_017440190.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09220, mitochondrial-like [Vigna angularis] BAU01470.1 hypothetical protein VIGAN_11071100 [Vigna angularis var. angularis] Length = 512 Score = 134 bits (336), Expect = 3e-35 Identities = 62/74 (83%), Positives = 70/74 (94%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 V+WRTLLGACSVHNNV+IGQRV K+LEMERGHGGDYVLMSNI +GV RFKDA+RLR++I Sbjct: 439 VMWRTLLGACSVHNNVDIGQRVIRKVLEMERGHGGDYVLMSNILVGVERFKDAQRLRDMI 498 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYS+V Sbjct: 499 DKRIAFKLPGYSIV 512 >XP_014519140.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09220, mitochondrial-like [Vigna radiata var. radiata] Length = 512 Score = 134 bits (336), Expect = 3e-35 Identities = 62/74 (83%), Positives = 70/74 (94%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 V+WRTLLGAC+VHNNVEIGQRV K+LEMERGHGGDYVLMSNI +GV RFKDA+RLR++I Sbjct: 439 VMWRTLLGACNVHNNVEIGQRVIRKVLEMERGHGGDYVLMSNILVGVERFKDAQRLRDMI 498 Query: 181 DKRIAFKLPGYSLV 222 DKRIAFKLPGYS+V Sbjct: 499 DKRIAFKLPGYSIV 512 >XP_003605068.1 PPR containing plant-like protein [Medicago truncatula] AES87265.1 PPR containing plant-like protein [Medicago truncatula] Length = 494 Score = 132 bits (332), Expect = 1e-34 Identities = 63/74 (85%), Positives = 68/74 (91%) Frame = +1 Query: 1 VIWRTLLGACSVHNNVEIGQRVTAKILEMERGHGGDYVLMSNIFIGVGRFKDAERLREII 180 VIWRTLLGACSVH+NVEIG+RVT KILEME+GHGGDYVLMSNIF VGRFKD ERLRE+I Sbjct: 421 VIWRTLLGACSVHDNVEIGKRVTKKILEMEKGHGGDYVLMSNIFASVGRFKDVERLREMI 480 Query: 181 DKRIAFKLPGYSLV 222 DKR FKLPGYS+V Sbjct: 481 DKRNVFKLPGYSIV 494