BLASTX nr result
ID: Glycyrrhiza28_contig00022662
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00022662 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007133080.1 hypothetical protein PHAVU_011G1498000g [Phaseolu... 51 6e-06 XP_007133079.1 hypothetical protein PHAVU_011G1498000g, partial ... 51 6e-06 >XP_007133080.1 hypothetical protein PHAVU_011G1498000g [Phaseolus vulgaris] ESW05074.1 hypothetical protein PHAVU_011G1498000g [Phaseolus vulgaris] Length = 157 Score = 50.8 bits (120), Expect = 6e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +3 Query: 153 KATMQCDSNQAKLC*NCDERVHNANFLVAK 242 +A M CDS+QAKLC +CDE+VH+ANFLVAK Sbjct: 12 RAMMLCDSDQAKLCWDCDEKVHSANFLVAK 41 >XP_007133079.1 hypothetical protein PHAVU_011G1498000g, partial [Phaseolus vulgaris] ESW05073.1 hypothetical protein PHAVU_011G1498000g, partial [Phaseolus vulgaris] Length = 163 Score = 50.8 bits (120), Expect = 6e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +3 Query: 153 KATMQCDSNQAKLC*NCDERVHNANFLVAK 242 +A M CDS+QAKLC +CDE+VH+ANFLVAK Sbjct: 12 RAMMLCDSDQAKLCWDCDEKVHSANFLVAK 41